Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RUJ9

Protein Details
Accession F4RUJ9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
131-154DATLPDPSNKKKNTRKAKVHVVKSHydrophilic
NLS Segment(s)
PositionSequence
141-147KKNTRKA
Subcellular Location(s) cyto_nucl 14.333, nucl 13, cyto 9.5, cyto_mito 7.498
Family & Domain DBs
KEGG mlr:MELLADRAFT_89769  -  
Amino Acid Sequences MGYLMTLMDLSVLDFTYKTFQPTESFIHSPNISIMCPPNSLLAPPLSASIAPPSTGPTLRPRTPTRPKPGFIALSPDLRVSSLRVSPGLEPTESDHTEDNYIASSGQSDTSDGIGSQEVIEIHSDDGSLPDATLPDPSNKKKNTRKAKVHVVKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.11
4 0.12
5 0.14
6 0.15
7 0.16
8 0.18
9 0.22
10 0.26
11 0.27
12 0.29
13 0.28
14 0.32
15 0.3
16 0.29
17 0.27
18 0.24
19 0.18
20 0.18
21 0.2
22 0.16
23 0.17
24 0.17
25 0.17
26 0.15
27 0.15
28 0.15
29 0.13
30 0.12
31 0.11
32 0.11
33 0.09
34 0.09
35 0.09
36 0.1
37 0.1
38 0.09
39 0.09
40 0.11
41 0.12
42 0.13
43 0.14
44 0.2
45 0.26
46 0.29
47 0.35
48 0.38
49 0.45
50 0.55
51 0.62
52 0.64
53 0.63
54 0.62
55 0.6
56 0.59
57 0.51
58 0.41
59 0.39
60 0.31
61 0.27
62 0.26
63 0.22
64 0.17
65 0.15
66 0.15
67 0.09
68 0.1
69 0.09
70 0.1
71 0.1
72 0.11
73 0.11
74 0.14
75 0.14
76 0.12
77 0.12
78 0.14
79 0.19
80 0.18
81 0.19
82 0.16
83 0.16
84 0.17
85 0.16
86 0.14
87 0.09
88 0.09
89 0.07
90 0.07
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.08
99 0.07
100 0.08
101 0.07
102 0.07
103 0.06
104 0.07
105 0.07
106 0.07
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.06
113 0.07
114 0.09
115 0.08
116 0.07
117 0.07
118 0.08
119 0.08
120 0.11
121 0.12
122 0.18
123 0.26
124 0.33
125 0.42
126 0.47
127 0.58
128 0.65
129 0.74
130 0.78
131 0.81
132 0.85
133 0.85
134 0.9