Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TPP2

Protein Details
Accession M7TPP2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
97-117LDDLRKAKNKITKRKVRFADSHydrophilic
NLS Segment(s)
PositionSequence
106-106K
109-109K
Subcellular Location(s) nucl 20.5, cyto_nucl 14.333, cyto 5, cyto_pero 3.499
Family & Domain DBs
Amino Acid Sequences MSTLTPPEDQPIKARSKFITPSQPQNATQLLNKTFGNILQVSSPPKSKSMNNLDPHLLVVMQVKNKHGDKYGRMESQEYLNKAGAIIVRDFGSQESLDDLRKAKNKITKRKVRFADSGYFDGSRDAEENMFDCEVDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.39
3 0.43
4 0.47
5 0.49
6 0.53
7 0.49
8 0.57
9 0.6
10 0.63
11 0.56
12 0.55
13 0.5
14 0.41
15 0.4
16 0.37
17 0.31
18 0.28
19 0.27
20 0.25
21 0.23
22 0.21
23 0.21
24 0.15
25 0.14
26 0.13
27 0.15
28 0.16
29 0.18
30 0.21
31 0.18
32 0.21
33 0.23
34 0.23
35 0.31
36 0.37
37 0.44
38 0.44
39 0.45
40 0.44
41 0.41
42 0.39
43 0.3
44 0.2
45 0.12
46 0.12
47 0.11
48 0.12
49 0.13
50 0.14
51 0.18
52 0.2
53 0.21
54 0.22
55 0.23
56 0.23
57 0.29
58 0.34
59 0.31
60 0.31
61 0.31
62 0.28
63 0.31
64 0.32
65 0.26
66 0.22
67 0.2
68 0.19
69 0.18
70 0.18
71 0.13
72 0.11
73 0.1
74 0.09
75 0.09
76 0.09
77 0.1
78 0.09
79 0.09
80 0.08
81 0.08
82 0.1
83 0.1
84 0.11
85 0.13
86 0.14
87 0.18
88 0.24
89 0.26
90 0.29
91 0.36
92 0.46
93 0.55
94 0.65
95 0.7
96 0.72
97 0.8
98 0.81
99 0.8
100 0.76
101 0.7
102 0.68
103 0.63
104 0.57
105 0.5
106 0.43
107 0.36
108 0.31
109 0.27
110 0.19
111 0.15
112 0.14
113 0.12
114 0.13
115 0.14
116 0.15
117 0.15