Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UA59

Protein Details
Accession M7UA59    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
104-124GKAKGKKKTGGSKSDKKRIKIBasic
NLS Segment(s)
PositionSequence
72-76SKPRR
104-123GKAKGKKKTGGSKSDKKRIK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MTSRPSPNDKPPDNLDRENRRAVTYPLVHDRHKGNPAKNKVIRVREPSSSISNNNRKVEPDVNDQKQRPDKSKPRRLIASIFGRKKADQTTRNHEGEEMNVENGKAKGKKKTGGSKSDKKRIKIPTLGQYIMNEGPGRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.65
4 0.67
5 0.68
6 0.62
7 0.56
8 0.51
9 0.46
10 0.45
11 0.39
12 0.39
13 0.41
14 0.43
15 0.42
16 0.43
17 0.44
18 0.42
19 0.47
20 0.48
21 0.47
22 0.53
23 0.59
24 0.65
25 0.66
26 0.68
27 0.67
28 0.68
29 0.67
30 0.65
31 0.61
32 0.54
33 0.53
34 0.48
35 0.46
36 0.4
37 0.38
38 0.4
39 0.44
40 0.48
41 0.47
42 0.45
43 0.41
44 0.43
45 0.43
46 0.37
47 0.38
48 0.4
49 0.43
50 0.48
51 0.47
52 0.49
53 0.51
54 0.5
55 0.46
56 0.47
57 0.52
58 0.57
59 0.66
60 0.67
61 0.65
62 0.65
63 0.63
64 0.57
65 0.54
66 0.54
67 0.53
68 0.49
69 0.46
70 0.44
71 0.42
72 0.41
73 0.41
74 0.39
75 0.38
76 0.42
77 0.48
78 0.54
79 0.54
80 0.51
81 0.45
82 0.37
83 0.31
84 0.3
85 0.22
86 0.15
87 0.15
88 0.14
89 0.15
90 0.15
91 0.2
92 0.2
93 0.23
94 0.31
95 0.36
96 0.43
97 0.49
98 0.59
99 0.62
100 0.68
101 0.73
102 0.75
103 0.8
104 0.84
105 0.82
106 0.75
107 0.75
108 0.74
109 0.73
110 0.72
111 0.69
112 0.69
113 0.69
114 0.67
115 0.61
116 0.52
117 0.48
118 0.39
119 0.35
120 0.26