FuNGI

M7UNJ8

Protein Details

Accession

M7UNJ8

Localization Confidence

Low

Confidence Score

8.6

NoLS Segment(s)

Position	Sequence	Protein Nature
415-441	DSSALKSQMKKSRNKRNSMVNSPPPTG	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 9, mito 6, cyto 4, pero 3, golg 3

Family & Domain DBs

InterPro	View protein in InterPro IPR004843 Calcineurin-like_PHP_ApaH IPR029052 Metallo-depent_PP-like IPR006186 Ser/Thr-sp_prot-phosphatase IPR031675 STPPase_N
Gene Ontology	GO:0017018 F:myosin phosphatase activity
Pfam	View protein in Pfam PF00149 Metallophos PF16891 STPPase_N

Amino Acid Sequences

MGNQPSKGSGSATPRRSASQTSLDRGSDNLSSYPSFSKADTKESNKSFRGALRSKIPGSKDSPRNSIAGIGSLVDSNDKSDVASLKSGKSAKSGWTSSVPGSPTLPQDSSEDIPSPADDLKPPPSPVQSPSVKSGHHDVSAAQRSGEVDHVSDQPPSGTVNPYAVGGRAGQSILVRRANEINPVDTATLLAAPMNGSNETALSTSNSAQISMGSLKDKDLDDYISRLLDAGYQGKSTKGVCLKSAEINSICLRAREIVLEQPPLIELEAPVKILPIAAIVAGKIFCVHGGLSPALSHMDDIRNIARPTDVPDYGLLNDLLWSDPADQEADWEQSERGVSYSFGKKVIQEFLLRHDFDLVCRAHMVVEDGYEFFEGRVLVTVFSAPNYCGEFDNYGAVMSVSTELLCSFELLKPLDSSALKSQMKKSRNKRNSMVNSPPPTGTFAPQSV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.46
2	0.49
3	0.49
4	0.48
5	0.45
6	0.46
7	0.47
8	0.48
9	0.5
10	0.47
11	0.44
12	0.4
13	0.38
14	0.29
15	0.26
16	0.21
17	0.19
18	0.19
19	0.21
20	0.23
21	0.22
22	0.21
23	0.2
24	0.28
25	0.27
26	0.35
27	0.41
28	0.46
29	0.52
30	0.57
31	0.64
32	0.57
33	0.57
34	0.52
35	0.49
36	0.52
37	0.47
38	0.47
39	0.47
40	0.51
41	0.53
42	0.55
43	0.53
44	0.49
45	0.51
46	0.55
47	0.56
48	0.55
49	0.57
50	0.54
51	0.52
52	0.46
53	0.44
54	0.34
55	0.27
56	0.21
57	0.16
58	0.14
59	0.13
60	0.13
61	0.1
62	0.1
63	0.09
64	0.1
65	0.09
66	0.09
67	0.11
68	0.13
69	0.14
70	0.19
71	0.2
72	0.2
73	0.26
74	0.28
75	0.26
76	0.27
77	0.27
78	0.28
79	0.33
80	0.33
81	0.3
82	0.32
83	0.34
84	0.32
85	0.34
86	0.29
87	0.23
88	0.23
89	0.23
90	0.22
91	0.23
92	0.22
93	0.2
94	0.21
95	0.24
96	0.23
97	0.23
98	0.21
99	0.18
100	0.17
101	0.16
102	0.16
103	0.13
104	0.12
105	0.12
106	0.14
107	0.19
108	0.22
109	0.24
110	0.25
111	0.27
112	0.29
113	0.3
114	0.34
115	0.34
116	0.33
117	0.37
118	0.37
119	0.34
120	0.34
121	0.37
122	0.31
123	0.27
124	0.25
125	0.2
126	0.26
127	0.32
128	0.3
129	0.24
130	0.22
131	0.21
132	0.22
133	0.23
134	0.15
135	0.1
136	0.12
137	0.14
138	0.14
139	0.14
140	0.13
141	0.11
142	0.11
143	0.12
144	0.11
145	0.1
146	0.1
147	0.11
148	0.11
149	0.12
150	0.11
151	0.1
152	0.09
153	0.08
154	0.08
155	0.08
156	0.07
157	0.07
158	0.08
159	0.11
160	0.14
161	0.17
162	0.16
163	0.17
164	0.21
165	0.21
166	0.26
167	0.24
168	0.21
169	0.19
170	0.2
171	0.18
172	0.14
173	0.14
174	0.08
175	0.06
176	0.05
177	0.05
178	0.04
179	0.04
180	0.04
181	0.05
182	0.05
183	0.05
184	0.05
185	0.05
186	0.06
187	0.06
188	0.06
189	0.06
190	0.07
191	0.07
192	0.11
193	0.1
194	0.1
195	0.1
196	0.09
197	0.1
198	0.1
199	0.1
200	0.08
201	0.08
202	0.08
203	0.1
204	0.1
205	0.1
206	0.1
207	0.11
208	0.1
209	0.11
210	0.12
211	0.09
212	0.09
213	0.08
214	0.07
215	0.06
216	0.07
217	0.08
218	0.08
219	0.09
220	0.09
221	0.09
222	0.11
223	0.1
224	0.14
225	0.16
226	0.16
227	0.17
228	0.19
229	0.21
230	0.23
231	0.24
232	0.23
233	0.19
234	0.2
235	0.2
236	0.2
237	0.18
238	0.15
239	0.14
240	0.12
241	0.12
242	0.11
243	0.11
244	0.13
245	0.15
246	0.16
247	0.15
248	0.14
249	0.14
250	0.13
251	0.12
252	0.07
253	0.05
254	0.07
255	0.07
256	0.07
257	0.07
258	0.07
259	0.07
260	0.06
261	0.06
262	0.04
263	0.04
264	0.04
265	0.04
266	0.04
267	0.05
268	0.05
269	0.05
270	0.05
271	0.04
272	0.04
273	0.05
274	0.05
275	0.05
276	0.08
277	0.08
278	0.08
279	0.08
280	0.09
281	0.09
282	0.09
283	0.08
284	0.08
285	0.09
286	0.1
287	0.12
288	0.13
289	0.18
290	0.18
291	0.18
292	0.17
293	0.16
294	0.21
295	0.24
296	0.22
297	0.18
298	0.19
299	0.2
300	0.19
301	0.2
302	0.15
303	0.1
304	0.1
305	0.09
306	0.09
307	0.07
308	0.08
309	0.07
310	0.08
311	0.08
312	0.09
313	0.08
314	0.1
315	0.12
316	0.12
317	0.11
318	0.12
319	0.12
320	0.12
321	0.12
322	0.11
323	0.1
324	0.09
325	0.09
326	0.14
327	0.2
328	0.2
329	0.22
330	0.22
331	0.24
332	0.26
333	0.3
334	0.27
335	0.25
336	0.25
337	0.3
338	0.36
339	0.34
340	0.31
341	0.31
342	0.29
343	0.25
344	0.31
345	0.25
346	0.19
347	0.19
348	0.19
349	0.14
350	0.15
351	0.17
352	0.1
353	0.11
354	0.11
355	0.11
356	0.11
357	0.11
358	0.11
359	0.08
360	0.09
361	0.08
362	0.07
363	0.1
364	0.1
365	0.09
366	0.1
367	0.12
368	0.1
369	0.11
370	0.12
371	0.1
372	0.12
373	0.14
374	0.14
375	0.14
376	0.16
377	0.17
378	0.17
379	0.19
380	0.16
381	0.15
382	0.14
383	0.12
384	0.09
385	0.08
386	0.09
387	0.06
388	0.06
389	0.06
390	0.06
391	0.07
392	0.08
393	0.08
394	0.09
395	0.11
396	0.16
397	0.17
398	0.19
399	0.18
400	0.19
401	0.23
402	0.22
403	0.25
404	0.26
405	0.35
406	0.37
407	0.41
408	0.49
409	0.53
410	0.61
411	0.66
412	0.71
413	0.72
414	0.78
415	0.83
416	0.82
417	0.84
418	0.86
419	0.85
420	0.85
421	0.83
422	0.8
423	0.74
424	0.68
425	0.58
426	0.54
427	0.46
428	0.4

M7UNJ8

3D AlphaFold-predicted Structure Viewer