Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7U3R2

Protein Details
Accession M7U3R2    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
334-369RDEGRDRERVRERDRHHDRDRSYRRDRDDHRERRSRBasic
NLS Segment(s)
PositionSequence
258-270KERKGGGKEVKRR
297-369KRLRPGGSSHSHRGSDRDKKKMGDYARERDERSHRRDRDEGRDRERVRERDRHHDRDRSYRRDRDDHRERRSR
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MLPSSDAPKISMKGFSLGAGSKNGSLKSNGRPQPKSGLGKRPRSSFAHDDEDSDNSDNGTSARRVKHEAVTGFADGGVIREGDEKRVAAPLVIPKQENKDWKGEARERKGMGRNLLPEEEQRRRAGEEKEEKADVVKGNDEEIKWGLTVKTKVKEELIDSERTIEQTTQVAKVEDNPKIKTEDELAIEALMGVESKRNGPDLIIASVNENGNDLVTEEDAYKRAIASAPDISTLEDYDAVPVEEFGAALLRGMGWDGKERKGGGKEVKRRQNLLGLGAKELKDAEELGAWVQKTDAKRLRPGGSSHSHRGSDRDKKKMGDYARERDERSHRRDRDEGRDRERVRERDRHHDRDRSYRRDRDDHRERRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.23
4 0.22
5 0.22
6 0.21
7 0.21
8 0.22
9 0.25
10 0.25
11 0.24
12 0.27
13 0.3
14 0.36
15 0.44
16 0.48
17 0.54
18 0.56
19 0.57
20 0.62
21 0.66
22 0.67
23 0.65
24 0.69
25 0.69
26 0.76
27 0.79
28 0.75
29 0.72
30 0.67
31 0.67
32 0.63
33 0.6
34 0.57
35 0.52
36 0.49
37 0.45
38 0.42
39 0.37
40 0.32
41 0.25
42 0.17
43 0.17
44 0.14
45 0.13
46 0.15
47 0.15
48 0.19
49 0.23
50 0.26
51 0.32
52 0.35
53 0.4
54 0.43
55 0.41
56 0.39
57 0.37
58 0.35
59 0.29
60 0.25
61 0.2
62 0.12
63 0.12
64 0.09
65 0.06
66 0.06
67 0.11
68 0.11
69 0.14
70 0.15
71 0.15
72 0.15
73 0.18
74 0.17
75 0.12
76 0.15
77 0.21
78 0.25
79 0.27
80 0.28
81 0.27
82 0.34
83 0.39
84 0.43
85 0.38
86 0.38
87 0.39
88 0.43
89 0.49
90 0.51
91 0.55
92 0.56
93 0.59
94 0.55
95 0.58
96 0.61
97 0.56
98 0.53
99 0.48
100 0.45
101 0.42
102 0.41
103 0.36
104 0.33
105 0.36
106 0.37
107 0.36
108 0.33
109 0.31
110 0.32
111 0.36
112 0.35
113 0.38
114 0.41
115 0.41
116 0.43
117 0.42
118 0.4
119 0.35
120 0.35
121 0.26
122 0.19
123 0.17
124 0.14
125 0.16
126 0.17
127 0.16
128 0.15
129 0.14
130 0.13
131 0.1
132 0.11
133 0.1
134 0.13
135 0.17
136 0.21
137 0.25
138 0.26
139 0.27
140 0.28
141 0.29
142 0.26
143 0.3
144 0.28
145 0.24
146 0.23
147 0.24
148 0.23
149 0.22
150 0.2
151 0.13
152 0.11
153 0.11
154 0.13
155 0.12
156 0.12
157 0.12
158 0.11
159 0.17
160 0.21
161 0.24
162 0.26
163 0.25
164 0.26
165 0.28
166 0.28
167 0.23
168 0.21
169 0.18
170 0.16
171 0.15
172 0.14
173 0.12
174 0.11
175 0.1
176 0.07
177 0.04
178 0.03
179 0.03
180 0.04
181 0.04
182 0.05
183 0.06
184 0.07
185 0.07
186 0.07
187 0.1
188 0.11
189 0.12
190 0.12
191 0.11
192 0.11
193 0.13
194 0.13
195 0.1
196 0.09
197 0.07
198 0.07
199 0.06
200 0.06
201 0.04
202 0.04
203 0.05
204 0.05
205 0.06
206 0.07
207 0.07
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.1
214 0.12
215 0.12
216 0.13
217 0.14
218 0.13
219 0.12
220 0.12
221 0.1
222 0.08
223 0.07
224 0.07
225 0.07
226 0.07
227 0.06
228 0.06
229 0.06
230 0.05
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.03
238 0.03
239 0.04
240 0.05
241 0.05
242 0.12
243 0.15
244 0.17
245 0.2
246 0.21
247 0.25
248 0.28
249 0.34
250 0.37
251 0.44
252 0.52
253 0.6
254 0.68
255 0.68
256 0.68
257 0.64
258 0.62
259 0.54
260 0.5
261 0.46
262 0.38
263 0.36
264 0.36
265 0.33
266 0.26
267 0.25
268 0.19
269 0.13
270 0.13
271 0.11
272 0.08
273 0.09
274 0.09
275 0.12
276 0.11
277 0.1
278 0.1
279 0.13
280 0.14
281 0.24
282 0.3
283 0.31
284 0.38
285 0.45
286 0.49
287 0.5
288 0.51
289 0.49
290 0.52
291 0.55
292 0.54
293 0.53
294 0.52
295 0.48
296 0.52
297 0.53
298 0.55
299 0.56
300 0.59
301 0.58
302 0.58
303 0.62
304 0.64
305 0.61
306 0.61
307 0.61
308 0.61
309 0.65
310 0.67
311 0.64
312 0.64
313 0.68
314 0.67
315 0.67
316 0.69
317 0.65
318 0.68
319 0.75
320 0.75
321 0.76
322 0.76
323 0.77
324 0.74
325 0.79
326 0.73
327 0.74
328 0.76
329 0.74
330 0.72
331 0.72
332 0.71
333 0.72
334 0.8
335 0.8
336 0.8
337 0.79
338 0.77
339 0.79
340 0.83
341 0.82
342 0.81
343 0.8
344 0.79
345 0.8
346 0.82
347 0.81
348 0.83
349 0.83