Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M7TGZ8

Protein Details
Accession M7TGZ8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
117-142LDLAERQRRILRRFRRKAKRLLSIVAHydrophilic
NLS Segment(s)
PositionSequence
124-136RRILRRFRRKAKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, cyto 4, cyto_mito 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR023780  Chromo_domain  
Gene Ontology GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF00385  Chromo  
Amino Acid Sequences MTTNNPAGHHLVLIDALNLESESEDSNSAESLASLESDSEERPPEKILAEIVGKNNHIWYLVKWRDCPLLYSSWEGEACFENYPWVFDQWLVNKQGQKEGKIQPFDLQAFDQACKDLDLAERQRRILRRFRRKAKRLLSIVAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.07
4 0.07
5 0.07
6 0.06
7 0.05
8 0.06
9 0.07
10 0.08
11 0.09
12 0.09
13 0.09
14 0.09
15 0.09
16 0.08
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.06
24 0.07
25 0.08
26 0.09
27 0.11
28 0.11
29 0.12
30 0.14
31 0.14
32 0.13
33 0.13
34 0.12
35 0.12
36 0.14
37 0.15
38 0.16
39 0.17
40 0.17
41 0.17
42 0.17
43 0.14
44 0.13
45 0.12
46 0.1
47 0.19
48 0.23
49 0.25
50 0.25
51 0.27
52 0.3
53 0.29
54 0.3
55 0.22
56 0.2
57 0.2
58 0.2
59 0.19
60 0.16
61 0.16
62 0.14
63 0.13
64 0.11
65 0.11
66 0.09
67 0.09
68 0.09
69 0.09
70 0.11
71 0.1
72 0.1
73 0.09
74 0.09
75 0.13
76 0.15
77 0.19
78 0.2
79 0.22
80 0.24
81 0.24
82 0.31
83 0.31
84 0.3
85 0.33
86 0.39
87 0.43
88 0.43
89 0.44
90 0.39
91 0.41
92 0.39
93 0.33
94 0.25
95 0.22
96 0.21
97 0.21
98 0.18
99 0.15
100 0.14
101 0.13
102 0.13
103 0.11
104 0.12
105 0.2
106 0.27
107 0.35
108 0.37
109 0.39
110 0.46
111 0.52
112 0.55
113 0.57
114 0.6
115 0.64
116 0.72
117 0.81
118 0.85
119 0.87
120 0.91
121 0.91
122 0.9
123 0.84