Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S563

Protein Details
Accession F4S563    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-98QLELRDLRRKRCRTRNQADKRRILRBasic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
KEGG mlr:MELLADRAFT_67985  -  
Amino Acid Sequences MVRRMNDMKKLLMESRNKLTRLLQDPNYTIKYIQAQWNRQRECQLKVIGTDSIKALTDKLAHLVDLEETLHQSQLELRDLRRKRCRTRNQADKRRILRLPETLTLFEEEIDSLIDELGAEEFRDIPGADSTQGRAMIRLRVSKGRLYDAKVGVLEAPKQANERAVW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.57
4 0.54
5 0.52
6 0.5
7 0.51
8 0.51
9 0.52
10 0.48
11 0.47
12 0.49
13 0.52
14 0.5
15 0.42
16 0.35
17 0.31
18 0.29
19 0.28
20 0.34
21 0.36
22 0.43
23 0.51
24 0.6
25 0.61
26 0.59
27 0.64
28 0.59
29 0.56
30 0.53
31 0.48
32 0.4
33 0.38
34 0.37
35 0.32
36 0.28
37 0.24
38 0.18
39 0.15
40 0.14
41 0.13
42 0.11
43 0.09
44 0.1
45 0.1
46 0.12
47 0.11
48 0.1
49 0.1
50 0.1
51 0.09
52 0.08
53 0.08
54 0.05
55 0.06
56 0.07
57 0.07
58 0.06
59 0.06
60 0.07
61 0.09
62 0.13
63 0.13
64 0.14
65 0.23
66 0.26
67 0.35
68 0.43
69 0.49
70 0.55
71 0.65
72 0.74
73 0.76
74 0.83
75 0.86
76 0.87
77 0.89
78 0.88
79 0.86
80 0.8
81 0.75
82 0.67
83 0.6
84 0.53
85 0.49
86 0.44
87 0.39
88 0.37
89 0.31
90 0.3
91 0.27
92 0.23
93 0.17
94 0.13
95 0.09
96 0.07
97 0.07
98 0.06
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.05
110 0.06
111 0.06
112 0.07
113 0.08
114 0.09
115 0.1
116 0.11
117 0.12
118 0.14
119 0.16
120 0.15
121 0.16
122 0.17
123 0.21
124 0.24
125 0.29
126 0.3
127 0.35
128 0.38
129 0.4
130 0.41
131 0.44
132 0.44
133 0.44
134 0.48
135 0.43
136 0.43
137 0.38
138 0.36
139 0.3
140 0.29
141 0.25
142 0.21
143 0.22
144 0.2
145 0.23
146 0.24