Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TFW7

Protein Details
Accession M7TFW7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-101GQQAKLGEGRRPRKRQRRIRKBasic
NLS Segment(s)
PositionSequence
86-101LGEGRRPRKRQRRIRK
Subcellular Location(s) mito 11, cyto_nucl 8, nucl 7, cyto 7
Family & Domain DBs
Amino Acid Sequences MPRVLLTLCSLSQEIFRLLERVHELHEKILDKDDVIHDWERRAEQVEGRLVRELAEKDATIVGHEAEIAALKAELAAVRAGQQAKLGEGRRPRKRQRRIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.15
4 0.14
5 0.14
6 0.17
7 0.19
8 0.18
9 0.2
10 0.23
11 0.24
12 0.24
13 0.28
14 0.26
15 0.23
16 0.26
17 0.23
18 0.18
19 0.19
20 0.18
21 0.15
22 0.17
23 0.19
24 0.16
25 0.17
26 0.18
27 0.17
28 0.16
29 0.18
30 0.15
31 0.14
32 0.17
33 0.21
34 0.21
35 0.21
36 0.21
37 0.18
38 0.17
39 0.18
40 0.15
41 0.11
42 0.12
43 0.11
44 0.11
45 0.12
46 0.11
47 0.09
48 0.09
49 0.07
50 0.06
51 0.06
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.1
67 0.11
68 0.11
69 0.14
70 0.14
71 0.16
72 0.22
73 0.22
74 0.25
75 0.34
76 0.44
77 0.52
78 0.62
79 0.71
80 0.76
81 0.85