Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UJG9

Protein Details
Accession M7UJG9    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
45-67LRKDRTGHSCKKKTNFEKLERVIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 4
Family & Domain DBs
Amino Acid Sequences MAVTWKTPKLTLLTRFKTTSSSSSTFSFSSSKDNESTLDDEAQALRKDRTGHSCKKKTNFEKLERVIIFCSLFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.5
4 0.48
5 0.43
6 0.38
7 0.34
8 0.31
9 0.29
10 0.29
11 0.31
12 0.27
13 0.26
14 0.23
15 0.17
16 0.2
17 0.19
18 0.2
19 0.19
20 0.19
21 0.18
22 0.19
23 0.2
24 0.15
25 0.14
26 0.11
27 0.11
28 0.11
29 0.13
30 0.12
31 0.12
32 0.11
33 0.13
34 0.16
35 0.19
36 0.28
37 0.33
38 0.42
39 0.51
40 0.6
41 0.66
42 0.72
43 0.79
44 0.78
45 0.81
46 0.81
47 0.78
48 0.8
49 0.76
50 0.77
51 0.67
52 0.61
53 0.51
54 0.44