Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TP33

Protein Details
Accession M7TP33   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
168-194LVVHCKKEGAPQPKKKSKKAGKEGEELBasic
NLS Segment(s)
PositionSequence
176-189GAPQPKKKSKKAGK
Subcellular Location(s) nucl 14, cyto_nucl 11.833, mito_nucl 9.333, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences MSAETATQPINTANAGKDADPIPLTKVDSAVQGLSSSPTEEKKTSGHRRTSSSAPGVWNINDLEKEGKELEIAKETQKLNWRINKSPMTLEDPEKSFLKKSLTTPPVKKIDLHFPLGLEVTARNMKGVTIKDAVDAIYKQFRKKADDELETPVLAGFEWDKDESWTRLVVHCKKEGAPQPKKKSKKAGKEGEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.19
5 0.18
6 0.2
7 0.19
8 0.18
9 0.17
10 0.19
11 0.2
12 0.17
13 0.18
14 0.16
15 0.17
16 0.18
17 0.15
18 0.13
19 0.12
20 0.11
21 0.12
22 0.11
23 0.11
24 0.12
25 0.14
26 0.18
27 0.18
28 0.2
29 0.23
30 0.33
31 0.42
32 0.49
33 0.55
34 0.55
35 0.6
36 0.62
37 0.62
38 0.58
39 0.51
40 0.45
41 0.38
42 0.36
43 0.32
44 0.27
45 0.25
46 0.19
47 0.17
48 0.14
49 0.14
50 0.14
51 0.12
52 0.14
53 0.12
54 0.12
55 0.11
56 0.12
57 0.12
58 0.13
59 0.14
60 0.14
61 0.19
62 0.19
63 0.21
64 0.28
65 0.32
66 0.35
67 0.41
68 0.45
69 0.43
70 0.5
71 0.5
72 0.44
73 0.41
74 0.37
75 0.36
76 0.33
77 0.32
78 0.27
79 0.25
80 0.25
81 0.24
82 0.22
83 0.17
84 0.17
85 0.18
86 0.18
87 0.19
88 0.27
89 0.32
90 0.38
91 0.4
92 0.45
93 0.47
94 0.45
95 0.44
96 0.38
97 0.41
98 0.38
99 0.38
100 0.31
101 0.26
102 0.26
103 0.24
104 0.21
105 0.12
106 0.09
107 0.08
108 0.1
109 0.1
110 0.09
111 0.09
112 0.09
113 0.13
114 0.14
115 0.15
116 0.15
117 0.16
118 0.16
119 0.16
120 0.16
121 0.14
122 0.14
123 0.12
124 0.18
125 0.2
126 0.22
127 0.26
128 0.28
129 0.32
130 0.34
131 0.41
132 0.41
133 0.44
134 0.45
135 0.47
136 0.46
137 0.4
138 0.38
139 0.28
140 0.2
141 0.14
142 0.13
143 0.07
144 0.06
145 0.09
146 0.09
147 0.1
148 0.13
149 0.17
150 0.18
151 0.19
152 0.2
153 0.19
154 0.24
155 0.33
156 0.38
157 0.4
158 0.42
159 0.44
160 0.43
161 0.51
162 0.55
163 0.57
164 0.6
165 0.65
166 0.72
167 0.79
168 0.86
169 0.86
170 0.88
171 0.88
172 0.88
173 0.88
174 0.88