Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UBG5

Protein Details
Accession M7UBG5    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-30EDNPSRSTTKKPRHGFKVGPDHydrophilic
170-192EFERKEREKKAKIEERERFRRQMBasic
NLS Segment(s)
PositionSequence
38-65RRKVIAIKKDLIHKAKVKKSYAKLKARE
133-208KDRKRERGERRAAKPAYFAKELAFAEKQKAEQQARREEFERKEREKKAKIEERERFRRQMAKARSGGKNGQRKLGR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAPTKRPREEDNPSRSTTKKPRHGFKVGPDNLPDGTWRRKVIAIKKDLIHKAKVKKSYAKLKAREPLKDERNIYADDEDKADEAAKNEEREDAAEGEESVELHPQRKAMLDEPEADTATKTVPRYSNNSEDAKDRKRERGERRAAKPAYFAKELAFAEKQKAEQQARREEFERKEREKKAKIEERERFRRQMAKARSGGKNGQRKLGRESQVLLEKVKRVVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.61
3 0.62
4 0.62
5 0.62
6 0.63
7 0.68
8 0.73
9 0.77
10 0.84
11 0.8
12 0.79
13 0.8
14 0.74
15 0.69
16 0.61
17 0.54
18 0.46
19 0.4
20 0.33
21 0.27
22 0.29
23 0.3
24 0.29
25 0.29
26 0.33
27 0.4
28 0.47
29 0.51
30 0.51
31 0.52
32 0.54
33 0.6
34 0.63
35 0.6
36 0.57
37 0.55
38 0.58
39 0.6
40 0.64
41 0.62
42 0.63
43 0.67
44 0.71
45 0.74
46 0.74
47 0.72
48 0.72
49 0.73
50 0.69
51 0.66
52 0.6
53 0.6
54 0.56
55 0.58
56 0.52
57 0.48
58 0.46
59 0.41
60 0.38
61 0.3
62 0.25
63 0.19
64 0.18
65 0.15
66 0.12
67 0.12
68 0.11
69 0.09
70 0.09
71 0.13
72 0.14
73 0.15
74 0.15
75 0.16
76 0.15
77 0.15
78 0.16
79 0.11
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.07
86 0.06
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.11
94 0.12
95 0.12
96 0.17
97 0.17
98 0.18
99 0.2
100 0.2
101 0.19
102 0.17
103 0.14
104 0.1
105 0.1
106 0.1
107 0.09
108 0.11
109 0.13
110 0.16
111 0.22
112 0.27
113 0.32
114 0.34
115 0.35
116 0.34
117 0.36
118 0.4
119 0.39
120 0.42
121 0.4
122 0.43
123 0.49
124 0.57
125 0.62
126 0.66
127 0.72
128 0.73
129 0.76
130 0.78
131 0.72
132 0.63
133 0.59
134 0.54
135 0.49
136 0.41
137 0.36
138 0.27
139 0.31
140 0.3
141 0.28
142 0.25
143 0.2
144 0.22
145 0.23
146 0.24
147 0.23
148 0.31
149 0.33
150 0.35
151 0.41
152 0.48
153 0.5
154 0.53
155 0.51
156 0.5
157 0.51
158 0.56
159 0.58
160 0.55
161 0.61
162 0.66
163 0.74
164 0.74
165 0.75
166 0.76
167 0.76
168 0.78
169 0.8
170 0.8
171 0.81
172 0.83
173 0.82
174 0.76
175 0.72
176 0.7
177 0.66
178 0.67
179 0.65
180 0.64
181 0.64
182 0.68
183 0.67
184 0.65
185 0.67
186 0.66
187 0.67
188 0.6
189 0.63
190 0.61
191 0.59
192 0.61
193 0.62
194 0.59
195 0.52
196 0.52
197 0.51
198 0.53
199 0.52
200 0.48
201 0.42
202 0.4
203 0.39