Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TQP2

Protein Details
Accession M7TQP2   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
120-148HPEPIGPVRPKKKSKKELKKIQKAQEAKEBasic
NLS Segment(s)
PositionSequence
127-161VRPKKKSKKELKKIQKAQEAKEKGWFKQNVKPDLR
Subcellular Location(s) nucl 20.5, cyto_nucl 13.833, mito_nucl 11.166, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MSAPEVTQNDLLAFHASHLGDTSTEHFAQQFLGPVEDYYEEEAEDDGLGYYPDGVKRTLTDEQIAIFRHSEIQTILRKRRHAAESSETRDEQPISETLRSVRTEKAEEEEDGEIPESFSHPEPIGPVRPKKKSKKELKKIQKAQEAKEKGWFKQNVKPDLRKRTWDKVEKSIGSLAYDDDEGGGNSQASSSAPQRRKITYDDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.14
3 0.13
4 0.13
5 0.14
6 0.13
7 0.11
8 0.13
9 0.15
10 0.15
11 0.16
12 0.16
13 0.15
14 0.15
15 0.16
16 0.16
17 0.16
18 0.13
19 0.14
20 0.13
21 0.13
22 0.15
23 0.14
24 0.14
25 0.12
26 0.12
27 0.1
28 0.1
29 0.1
30 0.09
31 0.08
32 0.07
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.06
39 0.08
40 0.09
41 0.09
42 0.1
43 0.11
44 0.16
45 0.19
46 0.19
47 0.19
48 0.18
49 0.19
50 0.21
51 0.22
52 0.17
53 0.14
54 0.13
55 0.15
56 0.15
57 0.15
58 0.13
59 0.17
60 0.22
61 0.29
62 0.36
63 0.37
64 0.39
65 0.4
66 0.46
67 0.46
68 0.43
69 0.41
70 0.42
71 0.45
72 0.48
73 0.49
74 0.43
75 0.39
76 0.36
77 0.31
78 0.23
79 0.17
80 0.14
81 0.13
82 0.13
83 0.13
84 0.13
85 0.16
86 0.17
87 0.17
88 0.17
89 0.17
90 0.18
91 0.18
92 0.2
93 0.18
94 0.17
95 0.17
96 0.16
97 0.14
98 0.12
99 0.12
100 0.09
101 0.08
102 0.07
103 0.06
104 0.07
105 0.07
106 0.08
107 0.08
108 0.08
109 0.1
110 0.12
111 0.18
112 0.22
113 0.3
114 0.36
115 0.45
116 0.54
117 0.63
118 0.71
119 0.76
120 0.82
121 0.85
122 0.89
123 0.91
124 0.93
125 0.94
126 0.92
127 0.9
128 0.88
129 0.82
130 0.76
131 0.76
132 0.69
133 0.59
134 0.59
135 0.53
136 0.46
137 0.51
138 0.51
139 0.45
140 0.47
141 0.55
142 0.55
143 0.6
144 0.68
145 0.67
146 0.72
147 0.73
148 0.75
149 0.74
150 0.75
151 0.77
152 0.77
153 0.73
154 0.72
155 0.75
156 0.67
157 0.63
158 0.56
159 0.47
160 0.38
161 0.33
162 0.24
163 0.17
164 0.16
165 0.13
166 0.1
167 0.09
168 0.08
169 0.09
170 0.09
171 0.07
172 0.07
173 0.07
174 0.07
175 0.08
176 0.11
177 0.17
178 0.26
179 0.32
180 0.4
181 0.45
182 0.49
183 0.52