Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TRB6

Protein Details
Accession M7TRB6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-64LASANKGKKKPKTVKQGQNTLVSHydrophilic
NLS Segment(s)
PositionSequence
45-53ANKGKKKPK
Subcellular Location(s) nucl 11.5, cyto_nucl 10.833, mito_nucl 10.166, cyto 8, mito 7.5
Family & Domain DBs
Amino Acid Sequences MGLPYGLRQFCKVCEGKADREEKLKQETDEKELKKKEASDALASANKGKKKPKTVKQGQNTLVSVAEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.41
4 0.46
5 0.49
6 0.42
7 0.47
8 0.49
9 0.43
10 0.45
11 0.41
12 0.35
13 0.38
14 0.38
15 0.37
16 0.42
17 0.4
18 0.41
19 0.4
20 0.4
21 0.35
22 0.34
23 0.32
24 0.29
25 0.3
26 0.24
27 0.23
28 0.25
29 0.25
30 0.24
31 0.25
32 0.24
33 0.26
34 0.29
35 0.36
36 0.41
37 0.5
38 0.6
39 0.65
40 0.72
41 0.79
42 0.84
43 0.86
44 0.88
45 0.82
46 0.79
47 0.7
48 0.6