Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UTB4

Protein Details
Accession M7UTB4   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
110-143TPSKNRVTKTKAAPRPRAKKTPAKKPAKKAEESDHydrophilic
NLS Segment(s)
PositionSequence
114-138NRVTKTKAAPRPRAKKTPAKKPAKK
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 10.333, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSDNDVASSQTQGNGGMSQSDVDFLMCCLRNTTGGSIQVDTQKVAQLLQYKNPRSVSNKVSFIKKKYDLPFGASSRTADEMAGGKAGKGDVSPKKASDANGTNEPAVPTTPSKNRVTKTKAAPRPRAKKTPAKKPAKKAEESDEELSDVKDDEMEDVKEEANEEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.11
4 0.1
5 0.1
6 0.09
7 0.09
8 0.08
9 0.08
10 0.07
11 0.07
12 0.13
13 0.14
14 0.14
15 0.15
16 0.16
17 0.18
18 0.2
19 0.23
20 0.21
21 0.23
22 0.24
23 0.23
24 0.24
25 0.26
26 0.25
27 0.22
28 0.18
29 0.17
30 0.15
31 0.15
32 0.15
33 0.19
34 0.2
35 0.27
36 0.35
37 0.35
38 0.39
39 0.41
40 0.42
41 0.4
42 0.45
43 0.44
44 0.42
45 0.47
46 0.45
47 0.52
48 0.53
49 0.51
50 0.52
51 0.48
52 0.5
53 0.46
54 0.51
55 0.43
56 0.44
57 0.46
58 0.4
59 0.39
60 0.32
61 0.28
62 0.22
63 0.22
64 0.17
65 0.11
66 0.1
67 0.09
68 0.09
69 0.09
70 0.08
71 0.06
72 0.06
73 0.07
74 0.06
75 0.05
76 0.11
77 0.14
78 0.19
79 0.2
80 0.2
81 0.23
82 0.25
83 0.26
84 0.27
85 0.27
86 0.26
87 0.3
88 0.3
89 0.28
90 0.27
91 0.26
92 0.2
93 0.15
94 0.13
95 0.11
96 0.15
97 0.2
98 0.24
99 0.3
100 0.35
101 0.38
102 0.45
103 0.5
104 0.53
105 0.58
106 0.63
107 0.67
108 0.71
109 0.78
110 0.8
111 0.83
112 0.84
113 0.83
114 0.8
115 0.81
116 0.81
117 0.82
118 0.82
119 0.83
120 0.84
121 0.85
122 0.88
123 0.86
124 0.82
125 0.76
126 0.74
127 0.71
128 0.68
129 0.61
130 0.51
131 0.43
132 0.39
133 0.34
134 0.25
135 0.18
136 0.12
137 0.1
138 0.09
139 0.1
140 0.12
141 0.13
142 0.14
143 0.15
144 0.15
145 0.15
146 0.15
147 0.14