Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7U776

Protein Details
Accession M7U776   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
189-209EIELRRQEKRVRRGKPLGEMRBasic
NLS Segment(s)
PositionSequence
192-206LRRQEKRVRRGKPLG
Subcellular Location(s) extr 6, E.R. 5, plas 4, golg 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MASLLIALVTAPALLATNEAIRQGQAKDRKEEHRARRCNLIASCVEASPLSLEVDHRQIVLRDSKLYINKDMNDSTLHPFAGYYLPYPDSNYEGLVSTITDVAPIMNWIYVDRETYEVKYGVRLDAQPNITGPFDCTRQDRRLTLEGWEGFCAVKEELNGEETSMWALYYDRDDDRLIGKLGKDRKIVEIELRRQEKRVRRGKPLGEMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.08
5 0.08
6 0.1
7 0.1
8 0.1
9 0.13
10 0.14
11 0.22
12 0.29
13 0.33
14 0.4
15 0.47
16 0.53
17 0.6
18 0.68
19 0.71
20 0.73
21 0.77
22 0.72
23 0.75
24 0.7
25 0.68
26 0.59
27 0.54
28 0.44
29 0.4
30 0.38
31 0.29
32 0.27
33 0.19
34 0.18
35 0.13
36 0.13
37 0.08
38 0.07
39 0.09
40 0.1
41 0.13
42 0.13
43 0.13
44 0.13
45 0.13
46 0.16
47 0.2
48 0.19
49 0.18
50 0.2
51 0.24
52 0.29
53 0.3
54 0.32
55 0.31
56 0.31
57 0.32
58 0.31
59 0.28
60 0.24
61 0.23
62 0.22
63 0.19
64 0.18
65 0.14
66 0.13
67 0.13
68 0.13
69 0.11
70 0.08
71 0.09
72 0.1
73 0.11
74 0.12
75 0.12
76 0.12
77 0.12
78 0.12
79 0.11
80 0.09
81 0.09
82 0.08
83 0.07
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.03
91 0.04
92 0.03
93 0.03
94 0.04
95 0.04
96 0.06
97 0.06
98 0.07
99 0.07
100 0.09
101 0.1
102 0.11
103 0.12
104 0.12
105 0.11
106 0.13
107 0.13
108 0.12
109 0.12
110 0.13
111 0.13
112 0.17
113 0.18
114 0.16
115 0.16
116 0.17
117 0.16
118 0.14
119 0.15
120 0.12
121 0.13
122 0.15
123 0.18
124 0.23
125 0.27
126 0.31
127 0.3
128 0.34
129 0.35
130 0.34
131 0.33
132 0.34
133 0.31
134 0.29
135 0.27
136 0.22
137 0.18
138 0.18
139 0.18
140 0.11
141 0.1
142 0.09
143 0.1
144 0.1
145 0.12
146 0.12
147 0.1
148 0.1
149 0.09
150 0.1
151 0.08
152 0.07
153 0.05
154 0.06
155 0.06
156 0.09
157 0.12
158 0.12
159 0.14
160 0.15
161 0.16
162 0.17
163 0.19
164 0.19
165 0.18
166 0.19
167 0.24
168 0.31
169 0.36
170 0.38
171 0.37
172 0.41
173 0.43
174 0.43
175 0.46
176 0.49
177 0.51
178 0.57
179 0.62
180 0.58
181 0.59
182 0.65
183 0.65
184 0.66
185 0.68
186 0.66
187 0.69
188 0.78
189 0.8