Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TTS1

Protein Details
Accession M7TTS1    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-86DLAEKEKAKRQKAKSKEKLIKQKKHGNGGGBasic
NLS Segment(s)
PositionSequence
51-84NAKKASDLAEKEKAKRQKAKSKEKLIKQKKHGNG
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPNHRASKVASRSPTPDVPDLISDHSDSTTESQKSAESKARALQIRKDAENAKKASDLAEKEKAKRQKAKSKEKLIKQKKHGNGGGGSGSGGTAHSGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.43
4 0.37
5 0.34
6 0.32
7 0.29
8 0.26
9 0.23
10 0.18
11 0.16
12 0.15
13 0.13
14 0.12
15 0.13
16 0.17
17 0.16
18 0.16
19 0.16
20 0.17
21 0.19
22 0.22
23 0.25
24 0.2
25 0.22
26 0.25
27 0.3
28 0.33
29 0.33
30 0.34
31 0.36
32 0.37
33 0.36
34 0.36
35 0.35
36 0.35
37 0.4
38 0.36
39 0.29
40 0.26
41 0.26
42 0.25
43 0.24
44 0.23
45 0.22
46 0.3
47 0.31
48 0.33
49 0.41
50 0.46
51 0.5
52 0.56
53 0.6
54 0.61
55 0.7
56 0.78
57 0.8
58 0.84
59 0.86
60 0.86
61 0.88
62 0.89
63 0.89
64 0.87
65 0.87
66 0.83
67 0.84
68 0.77
69 0.71
70 0.62
71 0.56
72 0.47
73 0.37
74 0.3
75 0.2
76 0.16
77 0.11
78 0.1