Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UB07

Protein Details
Accession M7UB07   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
28-51MEFERKRVERDKQLKRLNKNSDNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001915  Peptidase_M48  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004222  F:metalloendopeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF01435  Peptidase_M48  
Amino Acid Sequences MSRDHEFEADEEGMMIMWRAGYNPKACMEFERKRVERDKQLKRLNKNSDNEDNPALWRHPSHDQRLERLIRCHAGREGEVDGWWKENQLAVYDRKQRQDAEKQAREKLQKQKVTYQWKAPANVTRDTVSLGNSNRISNGKKETRPSTQLKGSKNKLKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.05
4 0.05
5 0.05
6 0.06
7 0.09
8 0.14
9 0.16
10 0.19
11 0.22
12 0.23
13 0.24
14 0.29
15 0.35
16 0.37
17 0.43
18 0.5
19 0.5
20 0.54
21 0.61
22 0.63
23 0.64
24 0.68
25 0.71
26 0.7
27 0.78
28 0.8
29 0.82
30 0.84
31 0.83
32 0.81
33 0.76
34 0.73
35 0.71
36 0.66
37 0.6
38 0.52
39 0.42
40 0.35
41 0.32
42 0.25
43 0.18
44 0.16
45 0.16
46 0.23
47 0.28
48 0.34
49 0.4
50 0.41
51 0.43
52 0.5
53 0.52
54 0.46
55 0.43
56 0.38
57 0.34
58 0.32
59 0.31
60 0.25
61 0.21
62 0.19
63 0.18
64 0.17
65 0.13
66 0.13
67 0.13
68 0.11
69 0.12
70 0.11
71 0.09
72 0.08
73 0.09
74 0.09
75 0.1
76 0.13
77 0.14
78 0.21
79 0.3
80 0.33
81 0.35
82 0.37
83 0.37
84 0.4
85 0.47
86 0.51
87 0.52
88 0.56
89 0.57
90 0.59
91 0.63
92 0.62
93 0.6
94 0.6
95 0.59
96 0.58
97 0.58
98 0.62
99 0.65
100 0.7
101 0.66
102 0.64
103 0.63
104 0.62
105 0.61
106 0.56
107 0.53
108 0.47
109 0.46
110 0.4
111 0.33
112 0.29
113 0.28
114 0.25
115 0.21
116 0.22
117 0.2
118 0.25
119 0.25
120 0.25
121 0.25
122 0.29
123 0.3
124 0.3
125 0.38
126 0.4
127 0.44
128 0.52
129 0.56
130 0.6
131 0.65
132 0.67
133 0.66
134 0.67
135 0.68
136 0.68
137 0.72
138 0.73