Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UDB9

Protein Details
Accession M7UDB9   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-93AFPTSSMKKKRFRYPKSQQTKRKVALVLHydrophilic
NLS Segment(s)
PositionSequence
74-76KKR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MPITQQREVYINIKKTPLEHGAILYGNVSLSAMDDLPLDDDDDDDDAFDKQRSHNYVKAQGKFLTAFPTSSMKKKRFRYPKSQQTKRKVALVLPAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.38
4 0.36
5 0.31
6 0.26
7 0.24
8 0.24
9 0.23
10 0.22
11 0.16
12 0.12
13 0.08
14 0.07
15 0.07
16 0.04
17 0.04
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.06
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.07
38 0.12
39 0.17
40 0.2
41 0.24
42 0.28
43 0.37
44 0.43
45 0.45
46 0.44
47 0.4
48 0.38
49 0.35
50 0.31
51 0.27
52 0.2
53 0.18
54 0.17
55 0.22
56 0.22
57 0.29
58 0.37
59 0.4
60 0.48
61 0.56
62 0.65
63 0.7
64 0.76
65 0.79
66 0.82
67 0.85
68 0.87
69 0.9
70 0.9
71 0.89
72 0.91
73 0.85
74 0.8
75 0.72
76 0.64