Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7UIU1

Protein Details
Accession M7UIU1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-26AIVRRRAAPKAPRTRNKANMKLDDKHydrophilic
NLS Segment(s)
PositionSequence
6-17RRAAPKAPRTRN
Subcellular Location(s) nucl 11.5, mito_nucl 11.333, cyto_nucl 9.666, mito 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MAIVRRRAAPKAPRTRNKANMKLDDKIARCPGGTPAYQHRKEFLKHRPSVTEAEVKMARGADYKPLRTFKGLPAGTKKPARLNREEYCIIRDWRVANGVAPFRKPKFDTKWGWNHEDAWDVYYMTGKDPALS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.86
4 0.87
5 0.86
6 0.83
7 0.83
8 0.78
9 0.73
10 0.69
11 0.66
12 0.57
13 0.54
14 0.49
15 0.4
16 0.35
17 0.33
18 0.31
19 0.28
20 0.27
21 0.25
22 0.31
23 0.4
24 0.44
25 0.43
26 0.42
27 0.42
28 0.45
29 0.49
30 0.49
31 0.49
32 0.5
33 0.52
34 0.51
35 0.5
36 0.5
37 0.45
38 0.41
39 0.3
40 0.31
41 0.28
42 0.26
43 0.23
44 0.2
45 0.17
46 0.12
47 0.12
48 0.16
49 0.18
50 0.2
51 0.23
52 0.26
53 0.26
54 0.27
55 0.29
56 0.23
57 0.3
58 0.29
59 0.27
60 0.32
61 0.35
62 0.38
63 0.39
64 0.39
65 0.38
66 0.44
67 0.47
68 0.47
69 0.52
70 0.5
71 0.53
72 0.54
73 0.46
74 0.42
75 0.41
76 0.35
77 0.29
78 0.28
79 0.22
80 0.21
81 0.22
82 0.19
83 0.17
84 0.2
85 0.25
86 0.24
87 0.26
88 0.3
89 0.3
90 0.36
91 0.37
92 0.41
93 0.44
94 0.51
95 0.56
96 0.59
97 0.68
98 0.68
99 0.7
100 0.63
101 0.57
102 0.49
103 0.46
104 0.37
105 0.29
106 0.24
107 0.18
108 0.17
109 0.19
110 0.17
111 0.14
112 0.17