Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7U055

Protein Details
Accession M7U055   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-48TSDSTPPIHHRQNRRRERPGSRARRTISHydrophilic
NLS Segment(s)
PositionSequence
31-49RQNRRRERPGSRARRTISR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVTTKLSSSSSSSSSPPLPHTSDSTPPIHHRQNRRRERPGSRARRTISRKSALATDLNEGILEARDSDFYIPNHRPGSGPSPILRQSFDQSWMRWKARQAAELEYLAIKQNMRQLEMERQTMVREAKGREEEELGKMQRRLFGGEEDDEDVSCDIDLCPAMLDVVMRLFDGEVDYLDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.3
4 0.32
5 0.32
6 0.32
7 0.36
8 0.36
9 0.39
10 0.41
11 0.39
12 0.38
13 0.4
14 0.46
15 0.5
16 0.53
17 0.59
18 0.64
19 0.72
20 0.79
21 0.84
22 0.85
23 0.85
24 0.87
25 0.86
26 0.87
27 0.87
28 0.84
29 0.83
30 0.76
31 0.77
32 0.76
33 0.75
34 0.72
35 0.67
36 0.6
37 0.54
38 0.53
39 0.46
40 0.41
41 0.32
42 0.26
43 0.2
44 0.19
45 0.17
46 0.13
47 0.11
48 0.08
49 0.07
50 0.05
51 0.05
52 0.05
53 0.06
54 0.07
55 0.1
56 0.1
57 0.17
58 0.17
59 0.21
60 0.22
61 0.22
62 0.21
63 0.21
64 0.25
65 0.22
66 0.22
67 0.19
68 0.22
69 0.25
70 0.26
71 0.24
72 0.2
73 0.2
74 0.19
75 0.23
76 0.21
77 0.18
78 0.24
79 0.29
80 0.29
81 0.29
82 0.3
83 0.34
84 0.34
85 0.38
86 0.33
87 0.31
88 0.31
89 0.29
90 0.28
91 0.19
92 0.17
93 0.14
94 0.13
95 0.09
96 0.08
97 0.12
98 0.13
99 0.14
100 0.15
101 0.17
102 0.25
103 0.29
104 0.29
105 0.25
106 0.25
107 0.24
108 0.27
109 0.25
110 0.19
111 0.2
112 0.2
113 0.25
114 0.29
115 0.29
116 0.26
117 0.29
118 0.28
119 0.26
120 0.31
121 0.27
122 0.27
123 0.29
124 0.29
125 0.29
126 0.28
127 0.28
128 0.24
129 0.25
130 0.24
131 0.24
132 0.24
133 0.23
134 0.22
135 0.19
136 0.18
137 0.15
138 0.11
139 0.1
140 0.08
141 0.06
142 0.07
143 0.07
144 0.06
145 0.07
146 0.06
147 0.07
148 0.06
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.07
156 0.07
157 0.08
158 0.08