Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TVM3

Protein Details
Accession M7TVM3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
245-266FEKVRIRDGKPKSKHRGEMEEQBasic
NLS Segment(s)
PositionSequence
143-150KPLKKPKV
Subcellular Location(s) nucl 15, cyto_nucl 13.333, cyto 10.5, mito_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MSGKAEKQPLDVADSNIKAPPAPILPPPKSRDKVPVKPPASKAATDNKRKASEIEQPQNLPEIDSDDERLHIVDQNCDQIRRKIRHFLESGEMKVTEFQKTIGTNSRSYGAFMGQSGKFKGDQSNVYTNAFAFFKKRELQGVKPLKKPKVSKAEEQKKFDVSAIKLDGESTTSVPVYDSCDEVRKKIRAYLREPGVTQAAFLREIAKTYPEEKKIQSKVLNDFLGKKGPSAGNTSSAYYASYVFFEKVRIRDGKPKSKHRGEMEEQWASEGGVDTKTPSSRGYFCFGDERPVEDKYGKVSFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.31
4 0.3
5 0.23
6 0.21
7 0.21
8 0.16
9 0.18
10 0.24
11 0.32
12 0.37
13 0.45
14 0.49
15 0.56
16 0.56
17 0.57
18 0.61
19 0.61
20 0.65
21 0.67
22 0.73
23 0.68
24 0.73
25 0.73
26 0.71
27 0.65
28 0.57
29 0.53
30 0.53
31 0.57
32 0.59
33 0.63
34 0.61
35 0.61
36 0.6
37 0.58
38 0.53
39 0.53
40 0.54
41 0.56
42 0.53
43 0.5
44 0.5
45 0.5
46 0.44
47 0.35
48 0.24
49 0.19
50 0.16
51 0.16
52 0.18
53 0.15
54 0.15
55 0.15
56 0.15
57 0.12
58 0.15
59 0.15
60 0.17
61 0.17
62 0.24
63 0.26
64 0.29
65 0.3
66 0.33
67 0.41
68 0.44
69 0.47
70 0.49
71 0.51
72 0.56
73 0.55
74 0.5
75 0.49
76 0.46
77 0.43
78 0.35
79 0.32
80 0.24
81 0.26
82 0.24
83 0.18
84 0.15
85 0.15
86 0.16
87 0.16
88 0.19
89 0.24
90 0.25
91 0.24
92 0.25
93 0.27
94 0.24
95 0.24
96 0.22
97 0.14
98 0.12
99 0.11
100 0.15
101 0.13
102 0.15
103 0.15
104 0.15
105 0.15
106 0.16
107 0.19
108 0.18
109 0.2
110 0.23
111 0.28
112 0.29
113 0.28
114 0.27
115 0.23
116 0.22
117 0.19
118 0.14
119 0.11
120 0.1
121 0.13
122 0.16
123 0.17
124 0.22
125 0.26
126 0.28
127 0.37
128 0.46
129 0.48
130 0.52
131 0.58
132 0.56
133 0.59
134 0.59
135 0.57
136 0.58
137 0.56
138 0.57
139 0.62
140 0.68
141 0.68
142 0.69
143 0.62
144 0.53
145 0.5
146 0.43
147 0.37
148 0.27
149 0.24
150 0.21
151 0.19
152 0.17
153 0.17
154 0.15
155 0.11
156 0.12
157 0.08
158 0.07
159 0.07
160 0.07
161 0.07
162 0.07
163 0.1
164 0.1
165 0.1
166 0.11
167 0.17
168 0.18
169 0.21
170 0.27
171 0.26
172 0.27
173 0.32
174 0.37
175 0.37
176 0.43
177 0.48
178 0.47
179 0.46
180 0.46
181 0.42
182 0.38
183 0.31
184 0.25
185 0.19
186 0.15
187 0.12
188 0.12
189 0.12
190 0.09
191 0.11
192 0.11
193 0.11
194 0.12
195 0.16
196 0.23
197 0.25
198 0.29
199 0.31
200 0.4
201 0.42
202 0.47
203 0.47
204 0.46
205 0.47
206 0.5
207 0.49
208 0.42
209 0.41
210 0.36
211 0.37
212 0.32
213 0.27
214 0.25
215 0.25
216 0.25
217 0.27
218 0.27
219 0.26
220 0.27
221 0.28
222 0.24
223 0.22
224 0.21
225 0.16
226 0.16
227 0.11
228 0.11
229 0.11
230 0.11
231 0.12
232 0.15
233 0.19
234 0.2
235 0.26
236 0.29
237 0.32
238 0.41
239 0.5
240 0.57
241 0.62
242 0.71
243 0.74
244 0.79
245 0.83
246 0.81
247 0.81
248 0.77
249 0.77
250 0.74
251 0.68
252 0.59
253 0.52
254 0.45
255 0.35
256 0.29
257 0.21
258 0.14
259 0.1
260 0.11
261 0.11
262 0.15
263 0.16
264 0.17
265 0.18
266 0.21
267 0.25
268 0.28
269 0.32
270 0.29
271 0.31
272 0.37
273 0.35
274 0.38
275 0.34
276 0.36
277 0.34
278 0.34
279 0.34
280 0.29
281 0.3
282 0.28