Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7TAK0

Protein Details
Accession M7TAK0    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-30RVLVNCKKRKFRLYHIKSNKTDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 7.5, cyto_nucl 6.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MRLPENIDRVLVNCKKRKFRLYHIKSNKTDVCPVCAGEDSGLNYGGPWEDEIESENELDPQKSTKTGKAVTGGTVAGGNVAGGNVAGGTVAGGTVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.58
3 0.65
4 0.73
5 0.7
6 0.75
7 0.77
8 0.78
9 0.82
10 0.83
11 0.85
12 0.78
13 0.78
14 0.73
15 0.64
16 0.63
17 0.53
18 0.46
19 0.37
20 0.36
21 0.29
22 0.24
23 0.21
24 0.14
25 0.14
26 0.1
27 0.1
28 0.1
29 0.08
30 0.07
31 0.07
32 0.07
33 0.06
34 0.04
35 0.05
36 0.05
37 0.05
38 0.06
39 0.07
40 0.08
41 0.08
42 0.07
43 0.08
44 0.09
45 0.09
46 0.08
47 0.09
48 0.1
49 0.14
50 0.16
51 0.18
52 0.23
53 0.25
54 0.27
55 0.29
56 0.29
57 0.26
58 0.26
59 0.22
60 0.17
61 0.15
62 0.12
63 0.08
64 0.07
65 0.05
66 0.04
67 0.04
68 0.03
69 0.03
70 0.03
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.02