Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S1P6

Protein Details
Accession F4S1P6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-91NGSGSKRRKGRSKSTQPRRQIKIEHydrophilic
NLS Segment(s)
PositionSequence
72-89SKRRKGRSKSTQPRRQIK
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033897  MADS_SRF-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000987  F:cis-regulatory region sequence-specific DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
KEGG mlr:MELLADRAFT_39098  -  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
CDD cd00266  MADS_SRF_like  
Amino Acid Sequences MDSASGTLNSSSSRTKKPLPSNSVQPSVEQESTPALTASDLGGTLVPQTAEELAELSTESDDEDGEVNGSGSKRRKGRSKSTQPRRQIKIEYIQDKSRRNITFGKRKNGIFKKANEISVLTGCEVMLIVAPKDSDHKAYTFATPKLQPMVTESAGETYIQNCLVSPILLFRLWTCSAFMLTYDVYISYSVMVHSCLVRPQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.52
4 0.61
5 0.69
6 0.7
7 0.71
8 0.74
9 0.76
10 0.75
11 0.66
12 0.57
13 0.52
14 0.49
15 0.43
16 0.33
17 0.27
18 0.23
19 0.23
20 0.22
21 0.17
22 0.11
23 0.1
24 0.1
25 0.09
26 0.07
27 0.06
28 0.06
29 0.05
30 0.05
31 0.06
32 0.06
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.07
56 0.07
57 0.11
58 0.14
59 0.2
60 0.25
61 0.3
62 0.4
63 0.46
64 0.56
65 0.63
66 0.71
67 0.76
68 0.82
69 0.86
70 0.87
71 0.89
72 0.83
73 0.77
74 0.69
75 0.63
76 0.61
77 0.59
78 0.54
79 0.48
80 0.49
81 0.49
82 0.49
83 0.47
84 0.45
85 0.38
86 0.36
87 0.41
88 0.43
89 0.48
90 0.5
91 0.56
92 0.53
93 0.54
94 0.61
95 0.59
96 0.6
97 0.55
98 0.51
99 0.53
100 0.51
101 0.5
102 0.41
103 0.35
104 0.28
105 0.24
106 0.22
107 0.13
108 0.1
109 0.09
110 0.08
111 0.07
112 0.05
113 0.05
114 0.05
115 0.04
116 0.05
117 0.05
118 0.05
119 0.09
120 0.1
121 0.12
122 0.13
123 0.13
124 0.16
125 0.18
126 0.22
127 0.24
128 0.25
129 0.27
130 0.26
131 0.28
132 0.28
133 0.27
134 0.22
135 0.21
136 0.25
137 0.21
138 0.21
139 0.19
140 0.17
141 0.17
142 0.17
143 0.14
144 0.09
145 0.1
146 0.09
147 0.09
148 0.07
149 0.09
150 0.09
151 0.08
152 0.08
153 0.09
154 0.11
155 0.11
156 0.11
157 0.11
158 0.16
159 0.17
160 0.18
161 0.17
162 0.15
163 0.16
164 0.16
165 0.16
166 0.13
167 0.12
168 0.12
169 0.11
170 0.1
171 0.1
172 0.1
173 0.1
174 0.07
175 0.08
176 0.08
177 0.08
178 0.09
179 0.09
180 0.11
181 0.12