Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RTC4

Protein Details
Accession F4RTC4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-35VLAPRPPPLRQRNPIPKRRPDPPTHydrophilic
NLS Segment(s)
PositionSequence
20-33LRQRNPIPKRRPDP
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
KEGG mlr:MELLADRAFT_64937  -  
Amino Acid Sequences MPLQRHQTQANVLAPRPPPLRQRNPIPKRRPDPPTTPVKDEKQPKKAFEPVELHPKKLNRLCLTLLMNDLSLTSTRTHTYRPSIKGRIIILKDLSKIPQPIPESARKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.39
4 0.38
5 0.41
6 0.47
7 0.56
8 0.58
9 0.68
10 0.72
11 0.79
12 0.85
13 0.85
14 0.85
15 0.81
16 0.82
17 0.79
18 0.74
19 0.71
20 0.68
21 0.69
22 0.64
23 0.63
24 0.61
25 0.57
26 0.58
27 0.61
28 0.62
29 0.62
30 0.61
31 0.59
32 0.58
33 0.59
34 0.53
35 0.49
36 0.45
37 0.38
38 0.45
39 0.42
40 0.38
41 0.36
42 0.36
43 0.36
44 0.35
45 0.4
46 0.31
47 0.33
48 0.33
49 0.34
50 0.35
51 0.29
52 0.26
53 0.19
54 0.16
55 0.13
56 0.12
57 0.08
58 0.07
59 0.08
60 0.08
61 0.09
62 0.11
63 0.12
64 0.14
65 0.18
66 0.26
67 0.32
68 0.38
69 0.44
70 0.48
71 0.5
72 0.52
73 0.52
74 0.52
75 0.46
76 0.44
77 0.4
78 0.38
79 0.38
80 0.35
81 0.34
82 0.31
83 0.31
84 0.28
85 0.31
86 0.31
87 0.35
88 0.39