Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5AKY1

Protein Details
Accession Q5AKY1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-32VSNPKTTALLKKPPKKYVKSSNLMIHydrophilic
278-298GSYSLMQTRLRRERRLKKKIKHydrophilic
NLS Segment(s)
PositionSequence
287-298LRRERRLKKKIK
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
KEGG cal:CAALFM_C113600WA  -  
Amino Acid Sequences MVPFLSEVSNPKTTALLKKPPKKYVKSSNLMIMPVKFTFVNKKSDYINHIANLKPLVSSTNLELFSSLDSRIANEIYEIGPKILPQPFSQEFLNLANHKFLPLSILTKKLEFQLSKGQVTNYNIKQSHPAKCPNRPNSQGGLGLFRVVPSKKRPTTKLNYSPTNKNNKHPDNNTNNDNNNNKPELDVKNDRYYSRLNIYELSKILDLHRYSIGLTKLIELNVLEMFGNYCDFQLGYQTWIRDTDKEKRRALIQQLYSYTSTFYPEIDSFKLEVIIRRGSYSLMQTRLRRERRLKKKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.45
4 0.52
5 0.62
6 0.7
7 0.77
8 0.82
9 0.81
10 0.83
11 0.84
12 0.84
13 0.81
14 0.76
15 0.74
16 0.67
17 0.61
18 0.54
19 0.44
20 0.37
21 0.3
22 0.28
23 0.2
24 0.2
25 0.27
26 0.28
27 0.35
28 0.33
29 0.36
30 0.38
31 0.43
32 0.47
33 0.42
34 0.42
35 0.37
36 0.39
37 0.37
38 0.35
39 0.32
40 0.26
41 0.2
42 0.16
43 0.15
44 0.14
45 0.15
46 0.15
47 0.19
48 0.19
49 0.19
50 0.19
51 0.18
52 0.17
53 0.17
54 0.14
55 0.1
56 0.1
57 0.11
58 0.12
59 0.12
60 0.1
61 0.09
62 0.1
63 0.09
64 0.11
65 0.11
66 0.1
67 0.1
68 0.1
69 0.14
70 0.16
71 0.17
72 0.16
73 0.23
74 0.24
75 0.27
76 0.27
77 0.23
78 0.21
79 0.22
80 0.26
81 0.2
82 0.19
83 0.19
84 0.19
85 0.18
86 0.17
87 0.14
88 0.11
89 0.11
90 0.15
91 0.15
92 0.19
93 0.2
94 0.2
95 0.21
96 0.21
97 0.26
98 0.21
99 0.22
100 0.27
101 0.3
102 0.31
103 0.31
104 0.3
105 0.29
106 0.32
107 0.36
108 0.29
109 0.33
110 0.31
111 0.31
112 0.38
113 0.39
114 0.43
115 0.4
116 0.48
117 0.46
118 0.55
119 0.64
120 0.63
121 0.66
122 0.63
123 0.62
124 0.55
125 0.52
126 0.45
127 0.36
128 0.31
129 0.23
130 0.19
131 0.15
132 0.12
133 0.13
134 0.11
135 0.14
136 0.17
137 0.26
138 0.31
139 0.36
140 0.4
141 0.46
142 0.54
143 0.61
144 0.65
145 0.63
146 0.66
147 0.66
148 0.69
149 0.68
150 0.71
151 0.63
152 0.61
153 0.64
154 0.63
155 0.67
156 0.64
157 0.66
158 0.64
159 0.66
160 0.64
161 0.6
162 0.54
163 0.52
164 0.5
165 0.43
166 0.38
167 0.35
168 0.29
169 0.25
170 0.29
171 0.25
172 0.29
173 0.33
174 0.34
175 0.4
176 0.42
177 0.41
178 0.38
179 0.38
180 0.34
181 0.33
182 0.3
183 0.24
184 0.25
185 0.27
186 0.27
187 0.25
188 0.23
189 0.19
190 0.17
191 0.17
192 0.2
193 0.19
194 0.18
195 0.18
196 0.16
197 0.16
198 0.2
199 0.2
200 0.15
201 0.15
202 0.15
203 0.16
204 0.15
205 0.15
206 0.11
207 0.11
208 0.1
209 0.1
210 0.08
211 0.06
212 0.07
213 0.07
214 0.08
215 0.07
216 0.06
217 0.06
218 0.07
219 0.06
220 0.1
221 0.1
222 0.13
223 0.15
224 0.16
225 0.16
226 0.21
227 0.22
228 0.23
229 0.28
230 0.35
231 0.43
232 0.5
233 0.52
234 0.52
235 0.55
236 0.58
237 0.62
238 0.61
239 0.57
240 0.55
241 0.55
242 0.55
243 0.51
244 0.43
245 0.36
246 0.26
247 0.24
248 0.18
249 0.16
250 0.17
251 0.17
252 0.21
253 0.21
254 0.23
255 0.2
256 0.21
257 0.24
258 0.2
259 0.23
260 0.24
261 0.28
262 0.26
263 0.27
264 0.27
265 0.25
266 0.27
267 0.3
268 0.32
269 0.33
270 0.4
271 0.43
272 0.53
273 0.62
274 0.67
275 0.69
276 0.73
277 0.78
278 0.82