Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M9LY54

Protein Details
Accession M9LY54    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
137-173LAEKTEKASRKLRKERKNRAKKVRGTKKTKAGDAKKKBasic
NLS Segment(s)
PositionSequence
138-173AEKTEKASRKLRKERKNRAKKVRGTKKTKAGDAKKK
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MATSAKHNNTAARPSTRIPSSDEVVLLVQIDDIRQTESITSDSTSPVTLRTRKFITNRLLQRKQMVLDVIHPARPNVSKAELSEKLSEMYKTPKEQCVVFGMRTAFGGGRSTGFALVYDSRDSMKFEPKHRLVRVGLAEKTEKASRKLRKERKNRAKKVRGTKKTKAGDAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.45
4 0.41
5 0.4
6 0.38
7 0.36
8 0.34
9 0.31
10 0.25
11 0.22
12 0.21
13 0.15
14 0.11
15 0.08
16 0.07
17 0.06
18 0.06
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.1
25 0.11
26 0.11
27 0.11
28 0.11
29 0.11
30 0.11
31 0.12
32 0.1
33 0.12
34 0.17
35 0.23
36 0.24
37 0.28
38 0.31
39 0.36
40 0.4
41 0.45
42 0.45
43 0.49
44 0.56
45 0.61
46 0.63
47 0.59
48 0.59
49 0.54
50 0.48
51 0.4
52 0.33
53 0.23
54 0.2
55 0.24
56 0.21
57 0.2
58 0.19
59 0.17
60 0.18
61 0.18
62 0.18
63 0.14
64 0.16
65 0.15
66 0.15
67 0.22
68 0.22
69 0.24
70 0.23
71 0.22
72 0.2
73 0.19
74 0.19
75 0.13
76 0.16
77 0.17
78 0.19
79 0.21
80 0.24
81 0.25
82 0.25
83 0.25
84 0.25
85 0.25
86 0.21
87 0.21
88 0.18
89 0.17
90 0.17
91 0.16
92 0.11
93 0.09
94 0.1
95 0.07
96 0.08
97 0.08
98 0.08
99 0.08
100 0.08
101 0.07
102 0.08
103 0.09
104 0.1
105 0.1
106 0.11
107 0.12
108 0.12
109 0.15
110 0.16
111 0.24
112 0.27
113 0.31
114 0.4
115 0.46
116 0.54
117 0.53
118 0.56
119 0.48
120 0.5
121 0.53
122 0.49
123 0.44
124 0.38
125 0.38
126 0.33
127 0.36
128 0.35
129 0.31
130 0.3
131 0.38
132 0.44
133 0.54
134 0.64
135 0.7
136 0.76
137 0.84
138 0.9
139 0.92
140 0.94
141 0.94
142 0.94
143 0.94
144 0.93
145 0.94
146 0.94
147 0.93
148 0.91
149 0.9
150 0.89
151 0.86
152 0.85
153 0.84