FuNGI

M9MBE5

Protein Details

Accession

M9MBE5

Localization Confidence

Medium

Confidence Score

12.6

NoLS Segment(s)

Position	Sequence	Protein Nature
3-25	ATASRRGSFPRPKGRSNQQVQDD	Hydrophilic
79-101	EQFSSVKSKKHVKKESNIHHAAP	Hydrophilic

NLS Segment(s)

Position	Sequence
124-147	APAGRGRGGASVRGARGGRGGFRG

Subcellular Location(s)

mito_nucl 10.832, nucl 10.5, mito 10.5, cyto_nucl 7.833

Family & Domain DBs

InterPro	View protein in InterPro IPR003892 CUE IPR041803 DEF1_CUE
Gene Ontology	GO:0000781 C:chromosome, telomeric region GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0043130 F:ubiquitin binding
Pfam	View protein in Pfam PF02845 CUE
PROSITE	View protein in PROSITE PS51140 CUE
CDD	cd14368 CUE_DEF1_like

Amino Acid Sequences

MSATASRRGSFPRPKGRSNQQVQDDTEEVRNLRAKYSDQLAMIRELFPTWTDEDLLFALQESLGDVENAVVRISEGQVEQFSSVKSKKHVKKESNIHHAAPAPHASAPPTTTAPHAARGNHIGAPAGRGRGGASVRGARGGRGGFRGVGGRGGGIAPQTNGHDVKTPETVEATTAQAFAPIATPTTGTSWAAALGRSNNKSQPAPAAPAAPAVPAPAPALVEESSAASLGAPVAPADTAAAPAPAAETVAPQATESATTTGALSSSNDKPVPAVKVPAPSKPAPKAAGMSWAQIARKSEAPKPAPAPAPAASAASEAAAAPSAETAAAESATAAPIESAASVQPDASAEQPAPDAVEAAAEPTAEPVADVKEDAAPAPAVSESVASGAAPAAESASAAPAAGPPGLSKAASRAPAQRSSQRARQDAPVVMAGGSSQLDKLGVQFGSLNFLGGDAEDAAETAEETPAAAEPEASPAAAAQTAAVPSAQRQDAQVGQAQTESYNQQPASAQYNGFKSDSFDNSYGFTGQQQQQQQTTPAQSAAQPQQQQQAAQEQIHGYNGYNSIGQGQAASQPQPQQGLQDYSSMYGGLDTQRLAQFYGAYDQGSNAFGQRSDDKSQQQASQQGQQSQQQAGSQQAGEPHQPQHHQGHQAGPGLQQAPQQQFPGIMPYYYPHYYMPNQFQHYAQPTAGYGQYPVYGQPAGQPQHPSKPGTPANIASPYSQGPQSDASAYGAQNHYGQTPSSAGLASYDQGFGRGMPGLGGMSDYSKIYGGAIPGLGGFLGSGAGGAPPSQNAASGNAGSGNAGTPHMGSQQKSGASSGSALDSYRQYDANASKGSAQSGAASGQVGRGQGQSQAQPQVQQQQQQQQAQQQQAQQQQQQQQYYQQYGAYGHQASSNAYSNYPYARQYWGQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.71
2	0.77
3	0.82
4	0.83
5	0.82
6	0.81
7	0.78
8	0.78
9	0.73
10	0.7
11	0.61
12	0.53
13	0.48
14	0.41
15	0.33
16	0.31
17	0.35
18	0.29
19	0.3
20	0.31
21	0.3
22	0.32
23	0.37
24	0.36
25	0.32
26	0.35
27	0.34
28	0.35
29	0.34
30	0.29
31	0.24
32	0.2
33	0.19
34	0.16
35	0.17
36	0.15
37	0.15
38	0.16
39	0.15
40	0.17
41	0.16
42	0.16
43	0.12
44	0.1
45	0.09
46	0.08
47	0.08
48	0.07
49	0.07
50	0.07
51	0.07
52	0.07
53	0.07
54	0.09
55	0.1
56	0.09
57	0.08
58	0.08
59	0.09
60	0.1
61	0.11
62	0.1
63	0.11
64	0.12
65	0.14
66	0.14
67	0.14
68	0.15
69	0.19
70	0.22
71	0.24
72	0.3
73	0.4
74	0.48
75	0.58
76	0.67
77	0.7
78	0.77
79	0.84
80	0.87
81	0.87
82	0.83
83	0.74
84	0.67
85	0.63
86	0.54
87	0.47
88	0.4
89	0.31
90	0.28
91	0.27
92	0.24
93	0.21
94	0.21
95	0.2
96	0.19
97	0.18
98	0.18
99	0.25
100	0.24
101	0.29
102	0.32
103	0.3
104	0.32
105	0.36
106	0.36
107	0.31
108	0.3
109	0.25
110	0.22
111	0.24
112	0.23
113	0.2
114	0.17
115	0.16
116	0.16
117	0.19
118	0.2
119	0.18
120	0.2
121	0.23
122	0.23
123	0.28
124	0.28
125	0.23
126	0.26
127	0.25
128	0.24
129	0.22
130	0.23
131	0.19
132	0.2
133	0.22
134	0.18
135	0.18
136	0.15
137	0.13
138	0.11
139	0.11
140	0.11
141	0.09
142	0.09
143	0.08
144	0.1
145	0.11
146	0.15
147	0.15
148	0.16
149	0.2
150	0.2
151	0.23
152	0.25
153	0.24
154	0.21
155	0.22
156	0.21
157	0.17
158	0.18
159	0.17
160	0.13
161	0.13
162	0.12
163	0.11
164	0.11
165	0.1
166	0.1
167	0.08
168	0.08
169	0.08
170	0.09
171	0.09
172	0.11
173	0.12
174	0.11
175	0.11
176	0.1
177	0.12
178	0.12
179	0.11
180	0.11
181	0.16
182	0.22
183	0.24
184	0.27
185	0.29
186	0.33
187	0.33
188	0.33
189	0.34
190	0.31
191	0.33
192	0.31
193	0.3
194	0.26
195	0.26
196	0.25
197	0.18
198	0.15
199	0.11
200	0.1
201	0.09
202	0.09
203	0.08
204	0.08
205	0.08
206	0.1
207	0.09
208	0.09
209	0.09
210	0.09
211	0.09
212	0.08
213	0.08
214	0.05
215	0.05
216	0.05
217	0.05
218	0.04
219	0.04
220	0.04
221	0.04
222	0.04
223	0.05
224	0.05
225	0.05
226	0.05
227	0.06
228	0.05
229	0.05
230	0.06
231	0.05
232	0.05
233	0.04
234	0.05
235	0.06
236	0.07
237	0.07
238	0.06
239	0.07
240	0.07
241	0.08
242	0.08
243	0.08
244	0.08
245	0.08
246	0.08
247	0.08
248	0.08
249	0.07
250	0.08
251	0.11
252	0.13
253	0.16
254	0.16
255	0.16
256	0.17
257	0.2
258	0.24
259	0.2
260	0.22
261	0.21
262	0.29
263	0.31
264	0.34
265	0.36
266	0.34
267	0.39
268	0.4
269	0.42
270	0.35
271	0.35
272	0.33
273	0.28
274	0.33
275	0.27
276	0.25
277	0.22
278	0.23
279	0.21
280	0.22
281	0.23
282	0.18
283	0.22
284	0.24
285	0.27
286	0.33
287	0.35
288	0.38
289	0.38
290	0.41
291	0.39
292	0.37
293	0.36
294	0.28
295	0.28
296	0.23
297	0.21
298	0.16
299	0.14
300	0.13
301	0.09
302	0.08
303	0.05
304	0.05
305	0.05
306	0.04
307	0.04
308	0.04
309	0.04
310	0.03
311	0.03
312	0.04
313	0.03
314	0.04
315	0.03
316	0.04
317	0.04
318	0.04
319	0.04
320	0.04
321	0.03
322	0.04
323	0.04
324	0.04
325	0.04
326	0.04
327	0.05
328	0.05
329	0.05
330	0.05
331	0.05
332	0.06
333	0.07
334	0.07
335	0.06
336	0.07
337	0.07
338	0.07
339	0.07
340	0.06
341	0.05
342	0.04
343	0.05
344	0.04
345	0.05
346	0.05
347	0.04
348	0.04
349	0.04
350	0.04
351	0.04
352	0.04
353	0.04
354	0.05
355	0.05
356	0.05
357	0.05
358	0.06
359	0.06
360	0.07
361	0.07
362	0.06
363	0.06
364	0.06
365	0.06
366	0.05
367	0.05
368	0.05
369	0.04
370	0.04
371	0.04
372	0.04
373	0.04
374	0.04
375	0.04
376	0.03
377	0.03
378	0.03
379	0.03
380	0.03
381	0.03
382	0.03
383	0.03
384	0.03
385	0.03
386	0.03
387	0.04
388	0.04
389	0.04
390	0.04
391	0.06
392	0.07
393	0.07
394	0.06
395	0.09
396	0.12
397	0.14
398	0.16
399	0.2
400	0.24
401	0.29
402	0.32
403	0.35
404	0.38
405	0.41
406	0.46
407	0.46
408	0.45
409	0.41
410	0.42
411	0.4
412	0.34
413	0.31
414	0.25
415	0.19
416	0.16
417	0.14
418	0.1
419	0.07
420	0.06
421	0.05
422	0.04
423	0.04
424	0.04
425	0.04
426	0.04
427	0.06
428	0.06
429	0.06
430	0.07
431	0.07
432	0.1
433	0.1
434	0.1
435	0.07
436	0.07
437	0.07
438	0.06
439	0.06
440	0.03
441	0.03
442	0.03
443	0.03
444	0.03
445	0.03
446	0.03
447	0.03
448	0.03
449	0.03
450	0.03
451	0.03
452	0.03
453	0.04
454	0.04
455	0.04
456	0.04
457	0.06
458	0.06
459	0.06
460	0.05
461	0.05
462	0.05
463	0.05
464	0.05
465	0.03
466	0.04
467	0.04
468	0.04
469	0.04
470	0.04
471	0.05
472	0.08
473	0.08
474	0.08
475	0.09
476	0.11
477	0.12
478	0.13
479	0.15
480	0.13
481	0.12
482	0.12
483	0.12
484	0.1
485	0.11
486	0.11
487	0.08
488	0.11
489	0.11
490	0.11
491	0.12
492	0.14
493	0.17
494	0.17
495	0.17
496	0.16
497	0.18
498	0.19
499	0.18
500	0.17
501	0.14
502	0.16
503	0.18
504	0.19
505	0.18
506	0.17
507	0.18
508	0.18
509	0.17
510	0.14
511	0.12
512	0.14
513	0.17
514	0.22
515	0.24
516	0.25
517	0.26
518	0.27
519	0.29
520	0.25
521	0.24
522	0.19
523	0.17
524	0.15
525	0.15
526	0.19
527	0.21
528	0.24
529	0.24
530	0.25
531	0.3
532	0.3
533	0.29
534	0.26
535	0.27
536	0.24
537	0.22
538	0.22
539	0.17
540	0.17
541	0.17
542	0.16
543	0.11
544	0.1
545	0.11
546	0.1
547	0.09
548	0.09
549	0.09
550	0.08
551	0.08
552	0.06
553	0.06
554	0.09
555	0.1
556	0.11
557	0.12
558	0.15
559	0.16
560	0.18
561	0.18
562	0.16
563	0.18
564	0.2
565	0.19
566	0.18
567	0.17
568	0.16
569	0.16
570	0.14
571	0.11
572	0.07
573	0.08
574	0.07
575	0.07
576	0.07
577	0.09
578	0.1
579	0.11
580	0.11
581	0.11
582	0.1
583	0.1
584	0.12
585	0.1
586	0.1
587	0.09
588	0.09
589	0.1
590	0.1
591	0.09
592	0.08
593	0.08
594	0.08
595	0.11
596	0.14
597	0.17
598	0.21
599	0.26
600	0.27
601	0.32
602	0.35
603	0.35
604	0.35
605	0.37
606	0.35
607	0.38
608	0.39
609	0.38
610	0.38
611	0.4
612	0.39
613	0.34
614	0.32
615	0.25
616	0.23
617	0.21
618	0.2
619	0.15
620	0.13
621	0.15
622	0.16
623	0.17
624	0.18
625	0.2
626	0.23
627	0.24
628	0.28
629	0.31
630	0.35
631	0.38
632	0.37
633	0.38
634	0.37
635	0.39
636	0.35
637	0.3
638	0.27
639	0.23
640	0.22
641	0.21
642	0.23
643	0.24
644	0.24
645	0.24
646	0.22
647	0.22
648	0.21
649	0.22
650	0.18
651	0.14
652	0.12
653	0.13
654	0.18
655	0.18
656	0.19
657	0.15
658	0.19
659	0.23
660	0.29
661	0.36
662	0.37
663	0.4
664	0.4
665	0.4
666	0.42
667	0.42
668	0.38
669	0.3
670	0.24
671	0.21
672	0.22
673	0.22
674	0.16
675	0.12
676	0.1
677	0.11
678	0.11
679	0.11
680	0.11
681	0.1
682	0.09
683	0.13
684	0.2
685	0.21
686	0.23
687	0.29
688	0.3
689	0.38
690	0.42
691	0.42
692	0.36
693	0.44
694	0.45
695	0.44
696	0.44
697	0.38
698	0.38
699	0.39
700	0.38
701	0.3
702	0.28
703	0.25
704	0.24
705	0.24
706	0.19
707	0.17
708	0.17
709	0.18
710	0.17
711	0.16
712	0.17
713	0.18
714	0.18
715	0.2
716	0.19
717	0.19
718	0.19
719	0.19
720	0.17
721	0.15
722	0.16
723	0.13
724	0.13
725	0.13
726	0.12
727	0.11
728	0.1
729	0.1
730	0.11
731	0.1
732	0.1
733	0.1
734	0.09
735	0.1
736	0.1
737	0.09
738	0.09
739	0.1
740	0.09
741	0.07
742	0.08
743	0.07
744	0.07
745	0.07
746	0.06
747	0.07
748	0.08
749	0.08
750	0.08
751	0.08
752	0.08
753	0.09
754	0.1
755	0.09
756	0.1
757	0.09
758	0.09
759	0.08
760	0.08
761	0.07
762	0.05
763	0.04
764	0.03
765	0.03
766	0.03
767	0.03
768	0.03
769	0.03
770	0.04
771	0.04
772	0.05
773	0.05
774	0.08
775	0.08
776	0.09
777	0.1
778	0.13
779	0.15
780	0.14
781	0.15
782	0.13
783	0.13
784	0.12
785	0.11
786	0.09
787	0.08
788	0.08
789	0.08
790	0.08
791	0.09
792	0.15
793	0.19
794	0.19
795	0.22
796	0.26
797	0.27
798	0.28
799	0.27
800	0.22
801	0.19
802	0.19
803	0.17
804	0.14
805	0.13
806	0.12
807	0.14
808	0.15
809	0.17
810	0.18
811	0.17
812	0.16
813	0.22
814	0.24
815	0.28
816	0.28
817	0.26
818	0.28
819	0.29
820	0.29
821	0.24
822	0.21
823	0.16
824	0.16
825	0.16
826	0.12
827	0.12
828	0.1
829	0.11
830	0.13
831	0.12
832	0.12
833	0.13
834	0.13
835	0.17
836	0.21
837	0.23
838	0.26
839	0.32
840	0.32
841	0.34
842	0.37
843	0.43
844	0.43
845	0.46
846	0.48
847	0.51
848	0.58
849	0.6
850	0.61
851	0.6
852	0.63
853	0.63
854	0.61
855	0.57
856	0.56
857	0.59
858	0.62
859	0.59
860	0.6
861	0.62
862	0.64
863	0.63
864	0.58
865	0.58
866	0.57
867	0.55
868	0.49
869	0.41
870	0.35
871	0.33
872	0.33
873	0.31
874	0.25
875	0.22
876	0.23
877	0.23
878	0.23
879	0.25
880	0.28
881	0.24
882	0.23
883	0.25
884	0.24
885	0.27
886	0.28
887	0.26
888	0.23

M9MBE5

3D AlphaFold-predicted Structure Viewer