Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M9MDQ6

Protein Details
Accession M9MDQ6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKSSSKKPTGSKRPPPLDTVHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKSSSKKPTGSKR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKKPTGSKRPPPLDTVFTCLFCNHEKAVSCKIDEKARIGYLSCKICGQKFSADTNPLDQPIDVYSLWIDACEDVANEQER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.88
4 0.81
5 0.76
6 0.7
7 0.65
8 0.56
9 0.52
10 0.43
11 0.36
12 0.34
13 0.28
14 0.26
15 0.21
16 0.22
17 0.16
18 0.17
19 0.17
20 0.2
21 0.26
22 0.25
23 0.25
24 0.26
25 0.27
26 0.29
27 0.28
28 0.27
29 0.23
30 0.23
31 0.22
32 0.19
33 0.19
34 0.2
35 0.21
36 0.19
37 0.18
38 0.19
39 0.2
40 0.21
41 0.21
42 0.2
43 0.22
44 0.26
45 0.28
46 0.3
47 0.3
48 0.32
49 0.31
50 0.27
51 0.24
52 0.19
53 0.16
54 0.13
55 0.15
56 0.12
57 0.11
58 0.1
59 0.1
60 0.1
61 0.09
62 0.09
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07