Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9M7R4

Protein Details
Accession M9M7R4   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-105AAKMLQKARRREQNRNAQRRLRDRKEHydrophilic
NLS Segment(s)
PositionSequence
82-104KMLQKARRREQNRNAQRRLRDRK
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MSAVTMHNVAWPAVAPAPMHYPPTYRAVPAYPASELYDVAAERAYDAYMPRDDVRPHMDESLVKKRTRQRVYPSEEAKQAAKMLQKARRREQNRNAQRRLRDRKEEHIFKLEAEVAQLRRQGEQQRAEMQGLEEMIRRLMEQRSELRHRLEALGGAPLGDDLTFGGEKSMRLAPLLSLPPLGAAGQASPSGRASRRETLAGNALGLEYEMPSQSTSWSASPSSGDRERPAVSPVQSSASSASVSTPRSPSSLGVSEPRSRTTSFHASGLRKSQPNFDLPLPRLKMDASNPILPPSLMPLPPVTAPWPHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.13
4 0.2
5 0.21
6 0.24
7 0.22
8 0.24
9 0.25
10 0.31
11 0.31
12 0.26
13 0.27
14 0.26
15 0.3
16 0.3
17 0.3
18 0.24
19 0.24
20 0.25
21 0.23
22 0.21
23 0.16
24 0.16
25 0.14
26 0.13
27 0.12
28 0.09
29 0.09
30 0.1
31 0.09
32 0.08
33 0.09
34 0.12
35 0.12
36 0.15
37 0.17
38 0.21
39 0.22
40 0.25
41 0.29
42 0.28
43 0.29
44 0.28
45 0.28
46 0.27
47 0.33
48 0.39
49 0.4
50 0.38
51 0.42
52 0.5
53 0.58
54 0.62
55 0.64
56 0.63
57 0.68
58 0.75
59 0.78
60 0.74
61 0.69
62 0.64
63 0.58
64 0.49
65 0.4
66 0.33
67 0.27
68 0.26
69 0.27
70 0.31
71 0.37
72 0.43
73 0.5
74 0.57
75 0.64
76 0.68
77 0.73
78 0.75
79 0.78
80 0.82
81 0.85
82 0.84
83 0.81
84 0.82
85 0.82
86 0.83
87 0.8
88 0.79
89 0.73
90 0.75
91 0.78
92 0.77
93 0.69
94 0.65
95 0.57
96 0.47
97 0.45
98 0.36
99 0.25
100 0.2
101 0.19
102 0.14
103 0.16
104 0.18
105 0.17
106 0.16
107 0.21
108 0.25
109 0.28
110 0.31
111 0.32
112 0.34
113 0.34
114 0.34
115 0.3
116 0.25
117 0.19
118 0.15
119 0.12
120 0.09
121 0.07
122 0.07
123 0.07
124 0.07
125 0.09
126 0.1
127 0.11
128 0.13
129 0.17
130 0.23
131 0.28
132 0.31
133 0.3
134 0.3
135 0.3
136 0.27
137 0.23
138 0.17
139 0.13
140 0.11
141 0.09
142 0.07
143 0.06
144 0.05
145 0.05
146 0.04
147 0.03
148 0.02
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.05
155 0.08
156 0.09
157 0.08
158 0.08
159 0.09
160 0.09
161 0.12
162 0.13
163 0.11
164 0.1
165 0.09
166 0.09
167 0.09
168 0.09
169 0.05
170 0.04
171 0.04
172 0.05
173 0.06
174 0.06
175 0.06
176 0.07
177 0.1
178 0.12
179 0.17
180 0.21
181 0.25
182 0.27
183 0.29
184 0.29
185 0.28
186 0.31
187 0.27
188 0.21
189 0.16
190 0.14
191 0.12
192 0.11
193 0.08
194 0.04
195 0.04
196 0.04
197 0.05
198 0.05
199 0.06
200 0.06
201 0.08
202 0.09
203 0.09
204 0.11
205 0.11
206 0.11
207 0.13
208 0.14
209 0.2
210 0.21
211 0.23
212 0.23
213 0.26
214 0.27
215 0.26
216 0.27
217 0.25
218 0.23
219 0.23
220 0.22
221 0.22
222 0.21
223 0.2
224 0.2
225 0.16
226 0.15
227 0.13
228 0.14
229 0.14
230 0.16
231 0.18
232 0.19
233 0.19
234 0.2
235 0.22
236 0.21
237 0.23
238 0.23
239 0.23
240 0.26
241 0.3
242 0.34
243 0.35
244 0.37
245 0.34
246 0.33
247 0.33
248 0.35
249 0.4
250 0.35
251 0.39
252 0.43
253 0.43
254 0.47
255 0.52
256 0.52
257 0.48
258 0.47
259 0.5
260 0.46
261 0.47
262 0.46
263 0.45
264 0.46
265 0.43
266 0.51
267 0.47
268 0.43
269 0.4
270 0.37
271 0.37
272 0.32
273 0.4
274 0.35
275 0.38
276 0.38
277 0.39
278 0.39
279 0.33
280 0.29
281 0.26
282 0.26
283 0.21
284 0.22
285 0.21
286 0.23
287 0.23
288 0.25
289 0.22