Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9MFR1

Protein Details
Accession M9MFR1   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
139-164SNGSKVKAEPKPKKKATKKRAAADDDHydrophilic
NLS Segment(s)
PositionSequence
120-159AAKPAPAKSTPSKPKAAPASNGSKVKAEPKPKKKATKKRA
Subcellular Location(s) cyto 13, nucl 8, extr 3, mito 1, plas 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR014876  DEK_C  
IPR019835  SWIB_domain  
IPR036885  SWIB_MDM2_dom_sf  
IPR003121  SWIB_MDM2_domain  
Pfam View protein in Pfam  
PF02201  SWIB  
PROSITE View protein in PROSITE  
PS51998  DEK_C  
PS51925  SWIB_MDM2  
CDD cd10567  SWIB-MDM2_like  
Amino Acid Sequences MSQPHPLDPATVAILRPAIIQILNNADLSSISAKKVRAQLASLPPSALPPGLDLSASKKAVDEVIRDCFDHISKGMPAPPQPPTNSYNGTASAPASGGLALPGLGGVRGGHTATPPSAPAAKPAPAKSTPSKPKAAPASNGSKVKAEPKPKKKATKKRAAADDDDEDEEPRKKRAANPNNPFNRPLILSPKLADVCGGDEMPRHAVVKQLWAYIKSNNLQNESNKRQILCDAKLTDIFGKEAVDSFEMAKLIGSHLTKKDVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.13
5 0.1
6 0.1
7 0.1
8 0.11
9 0.15
10 0.16
11 0.16
12 0.15
13 0.14
14 0.13
15 0.15
16 0.17
17 0.13
18 0.14
19 0.17
20 0.18
21 0.24
22 0.3
23 0.33
24 0.31
25 0.32
26 0.39
27 0.45
28 0.49
29 0.44
30 0.38
31 0.33
32 0.32
33 0.3
34 0.22
35 0.13
36 0.1
37 0.11
38 0.1
39 0.11
40 0.1
41 0.14
42 0.21
43 0.21
44 0.19
45 0.18
46 0.18
47 0.22
48 0.23
49 0.22
50 0.18
51 0.24
52 0.25
53 0.25
54 0.25
55 0.23
56 0.21
57 0.2
58 0.16
59 0.13
60 0.13
61 0.15
62 0.17
63 0.18
64 0.2
65 0.21
66 0.25
67 0.27
68 0.27
69 0.29
70 0.29
71 0.31
72 0.32
73 0.3
74 0.27
75 0.25
76 0.24
77 0.2
78 0.18
79 0.13
80 0.11
81 0.09
82 0.07
83 0.06
84 0.05
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.04
96 0.04
97 0.05
98 0.05
99 0.06
100 0.07
101 0.07
102 0.07
103 0.08
104 0.1
105 0.1
106 0.12
107 0.14
108 0.17
109 0.2
110 0.21
111 0.24
112 0.23
113 0.27
114 0.28
115 0.35
116 0.4
117 0.41
118 0.44
119 0.4
120 0.44
121 0.48
122 0.47
123 0.4
124 0.37
125 0.4
126 0.41
127 0.43
128 0.38
129 0.31
130 0.29
131 0.33
132 0.34
133 0.38
134 0.42
135 0.5
136 0.6
137 0.67
138 0.77
139 0.8
140 0.86
141 0.86
142 0.87
143 0.86
144 0.83
145 0.84
146 0.77
147 0.7
148 0.63
149 0.55
150 0.46
151 0.39
152 0.32
153 0.24
154 0.22
155 0.22
156 0.19
157 0.18
158 0.18
159 0.18
160 0.26
161 0.37
162 0.46
163 0.53
164 0.61
165 0.69
166 0.75
167 0.75
168 0.68
169 0.58
170 0.49
171 0.4
172 0.34
173 0.31
174 0.27
175 0.26
176 0.25
177 0.29
178 0.27
179 0.25
180 0.22
181 0.16
182 0.14
183 0.14
184 0.14
185 0.09
186 0.1
187 0.11
188 0.13
189 0.14
190 0.12
191 0.11
192 0.16
193 0.17
194 0.23
195 0.24
196 0.26
197 0.27
198 0.29
199 0.31
200 0.29
201 0.34
202 0.3
203 0.34
204 0.33
205 0.35
206 0.37
207 0.43
208 0.5
209 0.51
210 0.55
211 0.53
212 0.49
213 0.47
214 0.49
215 0.49
216 0.42
217 0.43
218 0.37
219 0.37
220 0.38
221 0.38
222 0.35
223 0.29
224 0.26
225 0.19
226 0.18
227 0.16
228 0.16
229 0.15
230 0.13
231 0.12
232 0.13
233 0.14
234 0.13
235 0.13
236 0.12
237 0.1
238 0.11
239 0.16
240 0.17
241 0.2
242 0.23