Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M9LSK0

Protein Details
Accession M9LSK0    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
158-180TFYSSAAPPKKRKPTNKPVLSGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, extr 8, cyto_nucl 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000008  C2_dom  
IPR035892  C2_domain_sf  
IPR037791  C2_fungal_Inn1  
Pfam View protein in Pfam  
PF00168  C2  
PROSITE View protein in PROSITE  
PS50004  C2  
CDD cd08681  C2_fungal_Inn1p-like  
Amino Acid Sequences MPPPSSEPVHKGTLVCVVLKARNLPNKKSIGKQDPYTVLTMGTEQQKTKPDKRGGQHPTWDEQLHFEIYEDMEDALAKASNTGSGSASKSAASSATDKLKGGKKVLKVACYADDSKEPEFIGDGIVDLTDTLKTGEFDEWVTIKAKDRYAGEVYLELTFYSSAAPPKKRKPTNKPVLSGTDTYGGAGTFQRIDDLADSAAPPKPPKGKTDHPPIPASMRPGGGAAAAAAASAANSHGRMSSSMSTSSLASSLHRPAGSLSHSQTMHDLGAGTIRPSSSLANLDAYTPAYAPASISRSTSPVPPSSAYHSAAPSHASHASHASHSSSIGPAAGSSRRNSFAAPPLSEFGHTVAPSASYYAQHSMTPSQSHHHLAASAQQPSEANDDRYATIRPGTVVQQHQVQHHHHAQYAMPRSHSISHVPAYAQMPQPDYGADQLTHTMAQMSFHAPPAPAGADKPLPPPTPVQPEERPPQSHIYQTPAHLASLYTPPSTLGYAAQHEVHQGSQRPVSPAARPASALSQYSTSPAAQHAPSVVNAQAYYQQQASQPPPPPQQQQQPQVGAYLSQPQSAPPRAASPGVQQGYTPIPSPYSQPPAPQHHQQPPPAPQPQQAPPQPQPSPSGHVSRPLPSTQSSTSLASQAVPPPHAYSHLYQAVQQPSPPPAHAHAHTHSYSQSSWTGPPPAQSQPGYSAPPNGGGIPASTSGYLYTQGGEGWAPQRSPSPLPPIPQSQKYSAAPYPPTAAGYAYGSQAQYAYPQYQQQQPAYAAMHTSTSSGAVYQPNQYHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.27
4 0.27
5 0.28
6 0.3
7 0.35
8 0.36
9 0.44
10 0.5
11 0.52
12 0.57
13 0.62
14 0.65
15 0.66
16 0.69
17 0.69
18 0.7
19 0.69
20 0.69
21 0.65
22 0.63
23 0.56
24 0.46
25 0.36
26 0.3
27 0.27
28 0.24
29 0.25
30 0.26
31 0.25
32 0.3
33 0.38
34 0.46
35 0.52
36 0.57
37 0.6
38 0.65
39 0.7
40 0.77
41 0.77
42 0.77
43 0.78
44 0.72
45 0.67
46 0.64
47 0.58
48 0.48
49 0.44
50 0.38
51 0.31
52 0.26
53 0.22
54 0.18
55 0.17
56 0.17
57 0.14
58 0.1
59 0.09
60 0.09
61 0.08
62 0.08
63 0.09
64 0.08
65 0.08
66 0.08
67 0.1
68 0.11
69 0.12
70 0.12
71 0.14
72 0.17
73 0.18
74 0.18
75 0.16
76 0.16
77 0.15
78 0.15
79 0.14
80 0.15
81 0.18
82 0.24
83 0.25
84 0.25
85 0.32
86 0.37
87 0.4
88 0.44
89 0.45
90 0.44
91 0.53
92 0.57
93 0.54
94 0.5
95 0.48
96 0.45
97 0.44
98 0.41
99 0.33
100 0.34
101 0.34
102 0.32
103 0.31
104 0.27
105 0.22
106 0.21
107 0.18
108 0.14
109 0.1
110 0.09
111 0.07
112 0.07
113 0.06
114 0.05
115 0.06
116 0.05
117 0.05
118 0.06
119 0.06
120 0.07
121 0.09
122 0.1
123 0.1
124 0.11
125 0.14
126 0.14
127 0.14
128 0.16
129 0.16
130 0.21
131 0.24
132 0.25
133 0.27
134 0.27
135 0.31
136 0.32
137 0.32
138 0.28
139 0.25
140 0.24
141 0.21
142 0.19
143 0.13
144 0.11
145 0.09
146 0.08
147 0.08
148 0.09
149 0.14
150 0.21
151 0.29
152 0.36
153 0.46
154 0.57
155 0.65
156 0.74
157 0.79
158 0.84
159 0.87
160 0.88
161 0.83
162 0.78
163 0.75
164 0.68
165 0.59
166 0.49
167 0.41
168 0.33
169 0.28
170 0.23
171 0.16
172 0.12
173 0.11
174 0.11
175 0.08
176 0.08
177 0.08
178 0.08
179 0.09
180 0.09
181 0.09
182 0.08
183 0.08
184 0.08
185 0.1
186 0.12
187 0.13
188 0.14
189 0.18
190 0.26
191 0.28
192 0.32
193 0.39
194 0.45
195 0.52
196 0.62
197 0.64
198 0.61
199 0.61
200 0.57
201 0.54
202 0.47
203 0.43
204 0.35
205 0.27
206 0.23
207 0.21
208 0.19
209 0.14
210 0.12
211 0.07
212 0.05
213 0.04
214 0.04
215 0.03
216 0.03
217 0.03
218 0.03
219 0.04
220 0.04
221 0.04
222 0.05
223 0.06
224 0.07
225 0.08
226 0.12
227 0.13
228 0.15
229 0.15
230 0.16
231 0.16
232 0.16
233 0.15
234 0.12
235 0.1
236 0.1
237 0.12
238 0.14
239 0.16
240 0.15
241 0.15
242 0.15
243 0.18
244 0.2
245 0.2
246 0.2
247 0.22
248 0.23
249 0.23
250 0.23
251 0.21
252 0.18
253 0.15
254 0.13
255 0.07
256 0.09
257 0.09
258 0.08
259 0.07
260 0.07
261 0.07
262 0.08
263 0.09
264 0.08
265 0.1
266 0.11
267 0.12
268 0.12
269 0.12
270 0.12
271 0.12
272 0.1
273 0.09
274 0.08
275 0.07
276 0.06
277 0.06
278 0.08
279 0.11
280 0.11
281 0.12
282 0.12
283 0.15
284 0.16
285 0.19
286 0.19
287 0.18
288 0.2
289 0.2
290 0.21
291 0.25
292 0.28
293 0.26
294 0.24
295 0.24
296 0.22
297 0.21
298 0.21
299 0.16
300 0.15
301 0.16
302 0.14
303 0.14
304 0.16
305 0.17
306 0.15
307 0.16
308 0.14
309 0.12
310 0.12
311 0.12
312 0.1
313 0.09
314 0.08
315 0.07
316 0.06
317 0.07
318 0.1
319 0.11
320 0.12
321 0.15
322 0.16
323 0.17
324 0.18
325 0.18
326 0.22
327 0.25
328 0.24
329 0.23
330 0.22
331 0.22
332 0.22
333 0.2
334 0.14
335 0.13
336 0.11
337 0.11
338 0.09
339 0.09
340 0.09
341 0.1
342 0.09
343 0.07
344 0.08
345 0.1
346 0.11
347 0.1
348 0.12
349 0.12
350 0.13
351 0.14
352 0.14
353 0.14
354 0.16
355 0.17
356 0.17
357 0.15
358 0.14
359 0.12
360 0.18
361 0.19
362 0.18
363 0.16
364 0.15
365 0.15
366 0.16
367 0.21
368 0.16
369 0.14
370 0.14
371 0.15
372 0.15
373 0.16
374 0.15
375 0.11
376 0.11
377 0.1
378 0.09
379 0.09
380 0.11
381 0.14
382 0.15
383 0.15
384 0.19
385 0.21
386 0.23
387 0.26
388 0.26
389 0.28
390 0.31
391 0.31
392 0.27
393 0.26
394 0.25
395 0.27
396 0.32
397 0.27
398 0.23
399 0.22
400 0.23
401 0.24
402 0.24
403 0.2
404 0.16
405 0.16
406 0.16
407 0.15
408 0.17
409 0.16
410 0.18
411 0.18
412 0.17
413 0.17
414 0.16
415 0.17
416 0.14
417 0.13
418 0.11
419 0.1
420 0.09
421 0.08
422 0.08
423 0.08
424 0.08
425 0.07
426 0.07
427 0.06
428 0.07
429 0.07
430 0.09
431 0.09
432 0.09
433 0.1
434 0.09
435 0.09
436 0.1
437 0.1
438 0.08
439 0.08
440 0.1
441 0.1
442 0.12
443 0.15
444 0.19
445 0.19
446 0.2
447 0.22
448 0.24
449 0.3
450 0.32
451 0.34
452 0.33
453 0.38
454 0.42
455 0.45
456 0.42
457 0.37
458 0.4
459 0.36
460 0.37
461 0.32
462 0.32
463 0.28
464 0.27
465 0.29
466 0.24
467 0.22
468 0.18
469 0.17
470 0.14
471 0.16
472 0.16
473 0.12
474 0.11
475 0.12
476 0.12
477 0.13
478 0.11
479 0.09
480 0.09
481 0.11
482 0.12
483 0.12
484 0.12
485 0.12
486 0.13
487 0.12
488 0.14
489 0.15
490 0.16
491 0.18
492 0.2
493 0.21
494 0.23
495 0.24
496 0.23
497 0.26
498 0.27
499 0.24
500 0.23
501 0.22
502 0.23
503 0.23
504 0.21
505 0.16
506 0.15
507 0.15
508 0.16
509 0.16
510 0.12
511 0.11
512 0.11
513 0.14
514 0.12
515 0.13
516 0.13
517 0.12
518 0.13
519 0.14
520 0.14
521 0.11
522 0.11
523 0.11
524 0.14
525 0.14
526 0.15
527 0.14
528 0.15
529 0.16
530 0.21
531 0.24
532 0.25
533 0.29
534 0.34
535 0.39
536 0.43
537 0.47
538 0.48
539 0.55
540 0.57
541 0.6
542 0.6
543 0.57
544 0.52
545 0.48
546 0.41
547 0.32
548 0.25
549 0.25
550 0.19
551 0.18
552 0.18
553 0.19
554 0.25
555 0.26
556 0.27
557 0.19
558 0.22
559 0.22
560 0.24
561 0.23
562 0.21
563 0.28
564 0.27
565 0.26
566 0.23
567 0.23
568 0.25
569 0.25
570 0.21
571 0.13
572 0.14
573 0.14
574 0.19
575 0.22
576 0.26
577 0.26
578 0.31
579 0.38
580 0.45
581 0.49
582 0.53
583 0.56
584 0.58
585 0.63
586 0.63
587 0.63
588 0.62
589 0.64
590 0.63
591 0.57
592 0.52
593 0.52
594 0.53
595 0.55
596 0.53
597 0.53
598 0.52
599 0.59
600 0.56
601 0.52
602 0.51
603 0.45
604 0.45
605 0.41
606 0.42
607 0.34
608 0.39
609 0.39
610 0.39
611 0.39
612 0.35
613 0.34
614 0.3
615 0.34
616 0.29
617 0.3
618 0.29
619 0.28
620 0.27
621 0.26
622 0.24
623 0.2
624 0.2
625 0.21
626 0.21
627 0.2
628 0.2
629 0.2
630 0.21
631 0.23
632 0.24
633 0.21
634 0.26
635 0.3
636 0.29
637 0.3
638 0.36
639 0.38
640 0.36
641 0.35
642 0.3
643 0.29
644 0.31
645 0.29
646 0.25
647 0.25
648 0.3
649 0.32
650 0.36
651 0.35
652 0.39
653 0.39
654 0.37
655 0.34
656 0.3
657 0.28
658 0.25
659 0.24
660 0.2
661 0.22
662 0.24
663 0.27
664 0.25
665 0.29
666 0.29
667 0.31
668 0.35
669 0.33
670 0.32
671 0.33
672 0.36
673 0.36
674 0.33
675 0.32
676 0.27
677 0.29
678 0.27
679 0.22
680 0.19
681 0.15
682 0.15
683 0.13
684 0.14
685 0.12
686 0.11
687 0.11
688 0.11
689 0.12
690 0.13
691 0.11
692 0.1
693 0.09
694 0.09
695 0.1
696 0.09
697 0.11
698 0.13
699 0.16
700 0.15
701 0.16
702 0.21
703 0.24
704 0.29
705 0.31
706 0.37
707 0.38
708 0.42
709 0.47
710 0.53
711 0.56
712 0.59
713 0.59
714 0.54
715 0.57
716 0.56
717 0.57
718 0.5
719 0.5
720 0.45
721 0.42
722 0.42
723 0.35
724 0.34
725 0.28
726 0.25
727 0.2
728 0.2
729 0.19
730 0.16
731 0.18
732 0.16
733 0.16
734 0.15
735 0.14
736 0.14
737 0.16
738 0.18
739 0.18
740 0.24
741 0.28
742 0.35
743 0.42
744 0.41
745 0.42
746 0.41
747 0.43
748 0.39
749 0.35
750 0.29
751 0.23
752 0.22
753 0.17
754 0.17
755 0.13
756 0.12
757 0.12
758 0.11
759 0.14
760 0.17
761 0.19
762 0.25