Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M9MD65

Protein Details
Accession M9MD65    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
84-124EYQPSQRIRKRRHGFLARNKTKNGRKTLMRRRFRGKAKLSHBasic
NLS Segment(s)
PositionSequence
90-124RIRKRRHGFLARNKTKNGRKTLMRRRFRGKAKLSH
Subcellular Location(s) mito 17, nucl 6, extr 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRISPFRALVRLPTVAPTTRTLAAPIRTPALRANTTTYSPLLARLAPRTPLTAPPSVLALVAAQTPAVAASAAQTRCVTYGSEYQPSQRIRKRRHGFLARNKTKNGRKTLMRRRFRGKAKLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.26
4 0.28
5 0.26
6 0.25
7 0.25
8 0.25
9 0.24
10 0.26
11 0.26
12 0.27
13 0.26
14 0.26
15 0.24
16 0.25
17 0.27
18 0.28
19 0.27
20 0.25
21 0.28
22 0.27
23 0.28
24 0.29
25 0.25
26 0.2
27 0.18
28 0.18
29 0.14
30 0.13
31 0.13
32 0.15
33 0.16
34 0.17
35 0.17
36 0.18
37 0.18
38 0.22
39 0.24
40 0.23
41 0.22
42 0.2
43 0.2
44 0.18
45 0.16
46 0.11
47 0.07
48 0.05
49 0.05
50 0.05
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.04
59 0.09
60 0.09
61 0.11
62 0.11
63 0.11
64 0.12
65 0.13
66 0.12
67 0.1
68 0.17
69 0.19
70 0.23
71 0.23
72 0.25
73 0.31
74 0.35
75 0.4
76 0.4
77 0.47
78 0.5
79 0.61
80 0.67
81 0.69
82 0.76
83 0.78
84 0.82
85 0.84
86 0.87
87 0.86
88 0.83
89 0.79
90 0.78
91 0.76
92 0.74
93 0.72
94 0.68
95 0.68
96 0.74
97 0.81
98 0.82
99 0.83
100 0.82
101 0.83
102 0.85
103 0.84
104 0.84