Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9LTV6

Protein Details
Accession M9LTV6   
Localization Confidence Low
Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
387-406AEQRRTPKGKAKARDSDDEEBasic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 6, plas 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007599  DER1  
IPR035952  Rhomboid-like_sf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006950  P:response to stress  
Pfam View protein in Pfam  
PF04511  DER1  
Amino Acid Sequences MDEIRKIPPVTRTILGATGAITLPCILAITSPWRYALSWPLVISKFHLHRVVTCFFFGGSGLKLLFDVFLIFRNSTDLELSHFGRRTAAYTWALLVMGTVILATNYPLGSPILFGPMLNALVYLWSRANPHSSVSFFGMVNCPSRWLPYVYIGIDLLQGGPGLAIQSATGLIAGYVYWMLDQVLPGQQRRRRGSYIPTPRFLENLLPDSLDPSLEGQNMGNRNARRVAGGTVWNAARDRGNRLSDTGPASPRPTSVASALGAGTRSTLSALNPFRGSRSASQTTGPSREEMLAAAERRLHASGSSSIVGRNAAERTPAKPAGSNTPGSTSLNARPAATSATTASANLRKTAAGSAQSKMFTFGQLNDSSRAHQQHEEDHSSSGGAVAEQRRTPKGKAKARDSDDEEEAPPTAGYTWGSGGQRLGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.24
4 0.2
5 0.17
6 0.16
7 0.13
8 0.11
9 0.09
10 0.08
11 0.08
12 0.07
13 0.05
14 0.05
15 0.08
16 0.14
17 0.18
18 0.19
19 0.2
20 0.21
21 0.22
22 0.24
23 0.3
24 0.28
25 0.28
26 0.28
27 0.33
28 0.33
29 0.33
30 0.34
31 0.35
32 0.33
33 0.35
34 0.39
35 0.34
36 0.38
37 0.43
38 0.44
39 0.38
40 0.34
41 0.29
42 0.24
43 0.24
44 0.19
45 0.15
46 0.11
47 0.11
48 0.1
49 0.1
50 0.1
51 0.1
52 0.09
53 0.07
54 0.08
55 0.07
56 0.1
57 0.13
58 0.13
59 0.13
60 0.15
61 0.16
62 0.15
63 0.16
64 0.12
65 0.14
66 0.17
67 0.2
68 0.23
69 0.24
70 0.23
71 0.24
72 0.24
73 0.23
74 0.22
75 0.25
76 0.21
77 0.2
78 0.21
79 0.19
80 0.18
81 0.15
82 0.13
83 0.07
84 0.05
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.09
100 0.09
101 0.09
102 0.09
103 0.1
104 0.1
105 0.09
106 0.09
107 0.06
108 0.07
109 0.07
110 0.08
111 0.07
112 0.08
113 0.1
114 0.11
115 0.15
116 0.15
117 0.17
118 0.18
119 0.18
120 0.19
121 0.2
122 0.21
123 0.17
124 0.18
125 0.18
126 0.17
127 0.19
128 0.16
129 0.17
130 0.15
131 0.17
132 0.17
133 0.17
134 0.18
135 0.19
136 0.22
137 0.2
138 0.2
139 0.18
140 0.17
141 0.14
142 0.13
143 0.09
144 0.05
145 0.05
146 0.04
147 0.04
148 0.03
149 0.03
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.04
167 0.04
168 0.04
169 0.05
170 0.09
171 0.11
172 0.13
173 0.2
174 0.23
175 0.31
176 0.36
177 0.4
178 0.4
179 0.41
180 0.47
181 0.5
182 0.59
183 0.55
184 0.54
185 0.51
186 0.48
187 0.45
188 0.38
189 0.31
190 0.21
191 0.2
192 0.17
193 0.14
194 0.14
195 0.14
196 0.13
197 0.1
198 0.08
199 0.06
200 0.07
201 0.07
202 0.08
203 0.07
204 0.1
205 0.12
206 0.14
207 0.17
208 0.16
209 0.18
210 0.2
211 0.2
212 0.17
213 0.17
214 0.16
215 0.14
216 0.17
217 0.15
218 0.16
219 0.16
220 0.16
221 0.15
222 0.14
223 0.15
224 0.14
225 0.19
226 0.21
227 0.23
228 0.23
229 0.25
230 0.26
231 0.25
232 0.27
233 0.25
234 0.21
235 0.21
236 0.22
237 0.2
238 0.19
239 0.19
240 0.17
241 0.16
242 0.15
243 0.15
244 0.13
245 0.13
246 0.13
247 0.11
248 0.1
249 0.08
250 0.08
251 0.06
252 0.06
253 0.06
254 0.07
255 0.07
256 0.14
257 0.15
258 0.17
259 0.19
260 0.19
261 0.19
262 0.21
263 0.23
264 0.2
265 0.27
266 0.28
267 0.28
268 0.29
269 0.32
270 0.34
271 0.35
272 0.31
273 0.25
274 0.22
275 0.21
276 0.2
277 0.16
278 0.15
279 0.15
280 0.15
281 0.15
282 0.15
283 0.14
284 0.16
285 0.16
286 0.14
287 0.1
288 0.13
289 0.14
290 0.15
291 0.16
292 0.14
293 0.14
294 0.15
295 0.15
296 0.12
297 0.13
298 0.11
299 0.11
300 0.16
301 0.17
302 0.18
303 0.25
304 0.27
305 0.25
306 0.27
307 0.29
308 0.33
309 0.35
310 0.36
311 0.3
312 0.31
313 0.32
314 0.29
315 0.29
316 0.24
317 0.24
318 0.28
319 0.28
320 0.24
321 0.23
322 0.23
323 0.24
324 0.2
325 0.17
326 0.12
327 0.14
328 0.14
329 0.14
330 0.17
331 0.19
332 0.2
333 0.2
334 0.2
335 0.17
336 0.18
337 0.21
338 0.2
339 0.22
340 0.24
341 0.25
342 0.27
343 0.28
344 0.27
345 0.28
346 0.25
347 0.21
348 0.2
349 0.2
350 0.22
351 0.25
352 0.27
353 0.27
354 0.28
355 0.28
356 0.32
357 0.34
358 0.32
359 0.33
360 0.33
361 0.38
362 0.44
363 0.48
364 0.43
365 0.4
366 0.37
367 0.32
368 0.29
369 0.22
370 0.15
371 0.09
372 0.13
373 0.16
374 0.2
375 0.23
376 0.28
377 0.33
378 0.37
379 0.42
380 0.47
381 0.53
382 0.58
383 0.65
384 0.71
385 0.75
386 0.76
387 0.8
388 0.78
389 0.73
390 0.68
391 0.61
392 0.52
393 0.43
394 0.38
395 0.29
396 0.22
397 0.17
398 0.13
399 0.11
400 0.11
401 0.11
402 0.12
403 0.17
404 0.18
405 0.19