Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M9MGK1

Protein Details
Accession M9MGK1    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
76-97LADVKSPKKVKRQNKNEAKLELHydrophilic
NLS Segment(s)
PositionSequence
83-87KKVKR
104-106KRK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MALCRTRYLSYAERGGQAGESFPHLSAPRSAFNATRTSQKRLNPISFSTSYITISTSILPTMAKNFYDSDTEVDELADVKSPKKVKRQNKNEAKLELGDDSPNKRKRAAGTGGRNSWTKEEEEDLLNCLQEIIAAGMTSFMHKYPRLAARKSDGCVKHWYSYRRKLETTLLGGPTINNNGKKINELVSPKKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.29
4 0.23
5 0.19
6 0.14
7 0.15
8 0.14
9 0.13
10 0.17
11 0.16
12 0.18
13 0.21
14 0.24
15 0.23
16 0.25
17 0.27
18 0.25
19 0.27
20 0.31
21 0.28
22 0.34
23 0.35
24 0.39
25 0.43
26 0.45
27 0.52
28 0.54
29 0.58
30 0.52
31 0.51
32 0.52
33 0.47
34 0.45
35 0.37
36 0.31
37 0.26
38 0.22
39 0.2
40 0.14
41 0.13
42 0.12
43 0.1
44 0.09
45 0.08
46 0.08
47 0.08
48 0.1
49 0.11
50 0.11
51 0.12
52 0.13
53 0.14
54 0.16
55 0.16
56 0.15
57 0.14
58 0.15
59 0.13
60 0.12
61 0.11
62 0.09
63 0.08
64 0.1
65 0.08
66 0.08
67 0.13
68 0.18
69 0.22
70 0.32
71 0.41
72 0.48
73 0.59
74 0.69
75 0.75
76 0.81
77 0.85
78 0.8
79 0.73
80 0.64
81 0.53
82 0.44
83 0.34
84 0.24
85 0.17
86 0.13
87 0.16
88 0.23
89 0.27
90 0.27
91 0.27
92 0.29
93 0.31
94 0.37
95 0.4
96 0.41
97 0.45
98 0.5
99 0.52
100 0.52
101 0.5
102 0.43
103 0.37
104 0.3
105 0.21
106 0.16
107 0.16
108 0.15
109 0.16
110 0.16
111 0.16
112 0.14
113 0.13
114 0.12
115 0.1
116 0.08
117 0.06
118 0.06
119 0.04
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.06
126 0.06
127 0.06
128 0.09
129 0.1
130 0.12
131 0.18
132 0.27
133 0.33
134 0.35
135 0.39
136 0.44
137 0.48
138 0.49
139 0.52
140 0.45
141 0.42
142 0.47
143 0.47
144 0.45
145 0.47
146 0.54
147 0.54
148 0.63
149 0.69
150 0.67
151 0.65
152 0.62
153 0.62
154 0.61
155 0.57
156 0.52
157 0.44
158 0.38
159 0.36
160 0.33
161 0.29
162 0.29
163 0.29
164 0.26
165 0.27
166 0.3
167 0.31
168 0.34
169 0.33
170 0.3
171 0.31
172 0.37
173 0.44