Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M9MAL6

Protein Details
Accession M9MAL6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
381-409GADKDEQKSKSKSKSKSKGSKAAKTSQPAHydrophilic
NLS Segment(s)
PositionSequence
44-46KKK
388-421KSKSKSKSKSKGSKAAKTSQPATRRSSRRSSAAK
Subcellular Location(s) plas 18, E.R. 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007369  Peptidase_A22B_SPP  
IPR006639  Preselin/SPP  
Gene Ontology GO:0016020  C:membrane  
GO:0004190  F:aspartic-type endopeptidase activity  
Pfam View protein in Pfam  
PF04258  Peptidase_A22B  
Amino Acid Sequences MAGDRDLLIAYAVLMSGALAPIYFGSFASLKTPKTTRELIKAAKKKREGGDDSDSDSDSDSDSDSDSDSDDDVLDRVTSSDAMWFPIMGSAVLFSLFLVFKYLDKRYVNLLLSFYFGFVGCLALSQALVSTSRGVVGGKVWKKLPSFRLQLDQRGQGRVFKLSFTTVDVGLLAVSAVLVGVYLVTKNWIISNLLALSLSLNAIALMSLDSFRTGAIMLGGLFVYDIFWVFATPVMVSVARNFDAPIKIVWPKNILEAVWALRAHETLPKLQFTMLGLGDIVIPGIFVSLALRYDQLVASEAKPSVGFTKTYTRFDKPYFRATLAAYVAGLATTMGVMHFFKAAQPALLYLSPACTGAVFLTAALRGELKQVWNWTDGEDEGADKDEQKSKSKSKSKSKGSKAAKTSQPATRRSSRRSSAAKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.06
11 0.05
12 0.09
13 0.09
14 0.1
15 0.17
16 0.2
17 0.21
18 0.27
19 0.3
20 0.31
21 0.36
22 0.44
23 0.44
24 0.49
25 0.55
26 0.58
27 0.65
28 0.71
29 0.74
30 0.76
31 0.76
32 0.75
33 0.74
34 0.75
35 0.7
36 0.68
37 0.67
38 0.6
39 0.59
40 0.53
41 0.46
42 0.36
43 0.32
44 0.24
45 0.17
46 0.14
47 0.11
48 0.09
49 0.1
50 0.1
51 0.1
52 0.1
53 0.1
54 0.1
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.11
68 0.11
69 0.13
70 0.13
71 0.12
72 0.11
73 0.12
74 0.13
75 0.08
76 0.08
77 0.06
78 0.06
79 0.06
80 0.06
81 0.04
82 0.06
83 0.06
84 0.06
85 0.08
86 0.08
87 0.1
88 0.15
89 0.18
90 0.22
91 0.23
92 0.25
93 0.27
94 0.33
95 0.33
96 0.3
97 0.29
98 0.23
99 0.24
100 0.23
101 0.18
102 0.12
103 0.1
104 0.09
105 0.07
106 0.08
107 0.05
108 0.06
109 0.06
110 0.05
111 0.05
112 0.04
113 0.04
114 0.04
115 0.05
116 0.06
117 0.06
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.09
124 0.17
125 0.19
126 0.22
127 0.23
128 0.27
129 0.29
130 0.35
131 0.38
132 0.38
133 0.41
134 0.4
135 0.48
136 0.47
137 0.52
138 0.5
139 0.51
140 0.45
141 0.44
142 0.42
143 0.36
144 0.35
145 0.32
146 0.28
147 0.21
148 0.2
149 0.18
150 0.18
151 0.16
152 0.16
153 0.12
154 0.11
155 0.11
156 0.09
157 0.08
158 0.07
159 0.04
160 0.03
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.01
167 0.02
168 0.02
169 0.02
170 0.02
171 0.04
172 0.04
173 0.04
174 0.05
175 0.06
176 0.07
177 0.07
178 0.08
179 0.07
180 0.07
181 0.07
182 0.07
183 0.06
184 0.05
185 0.05
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.04
202 0.03
203 0.04
204 0.03
205 0.04
206 0.04
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.04
220 0.05
221 0.05
222 0.06
223 0.06
224 0.07
225 0.08
226 0.08
227 0.09
228 0.09
229 0.1
230 0.11
231 0.12
232 0.11
233 0.12
234 0.16
235 0.17
236 0.18
237 0.18
238 0.18
239 0.2
240 0.2
241 0.17
242 0.14
243 0.14
244 0.14
245 0.14
246 0.13
247 0.12
248 0.11
249 0.11
250 0.11
251 0.13
252 0.13
253 0.15
254 0.17
255 0.18
256 0.18
257 0.18
258 0.18
259 0.15
260 0.17
261 0.12
262 0.1
263 0.09
264 0.09
265 0.09
266 0.08
267 0.07
268 0.03
269 0.03
270 0.03
271 0.03
272 0.02
273 0.02
274 0.03
275 0.04
276 0.04
277 0.05
278 0.06
279 0.06
280 0.07
281 0.07
282 0.08
283 0.09
284 0.1
285 0.1
286 0.13
287 0.12
288 0.12
289 0.12
290 0.12
291 0.13
292 0.13
293 0.14
294 0.14
295 0.24
296 0.28
297 0.34
298 0.38
299 0.39
300 0.42
301 0.47
302 0.54
303 0.48
304 0.52
305 0.5
306 0.46
307 0.45
308 0.41
309 0.41
310 0.31
311 0.27
312 0.19
313 0.15
314 0.14
315 0.11
316 0.1
317 0.04
318 0.03
319 0.03
320 0.03
321 0.03
322 0.04
323 0.05
324 0.05
325 0.06
326 0.06
327 0.08
328 0.12
329 0.12
330 0.12
331 0.12
332 0.12
333 0.14
334 0.14
335 0.14
336 0.1
337 0.12
338 0.12
339 0.12
340 0.11
341 0.08
342 0.08
343 0.08
344 0.09
345 0.07
346 0.07
347 0.07
348 0.08
349 0.08
350 0.08
351 0.09
352 0.08
353 0.11
354 0.13
355 0.14
356 0.18
357 0.22
358 0.24
359 0.26
360 0.26
361 0.24
362 0.23
363 0.21
364 0.19
365 0.15
366 0.14
367 0.12
368 0.14
369 0.14
370 0.13
371 0.17
372 0.23
373 0.25
374 0.32
375 0.4
376 0.46
377 0.56
378 0.64
379 0.7
380 0.74
381 0.82
382 0.85
383 0.88
384 0.89
385 0.89
386 0.9
387 0.89
388 0.85
389 0.84
390 0.81
391 0.78
392 0.74
393 0.72
394 0.7
395 0.67
396 0.67
397 0.67
398 0.68
399 0.69
400 0.72
401 0.71
402 0.72
403 0.74