Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9LUY1

Protein Details
Accession M9LUY1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-38GTSLKPSLNAKQRMRKKLQRAPTVHGHydrophilic
NLS Segment(s)
PositionSequence
6-30QRRKARSGTSLKPSLNAKQRMRKKL
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MANPRQRRKARSGTSLKPSLNAKQRMRKKLQRAPTVHGADILKDSYDPTLTLKQNYARLGLIPALGVRPNTGGTEKPAAAAAAGSSGESDKPRKGMARVIRDDDGNIVDIVEAPADQETTPWGKPLDNSVEERTDVHTFIPAASKTTTSVVDELQTRADNAEPVQRHTSTLETDWLAQLVAKHSDDYTAMARDRTLNPWQKTPGEIRRALNKARLTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.71
4 0.64
5 0.6
6 0.58
7 0.59
8 0.6
9 0.59
10 0.62
11 0.71
12 0.77
13 0.83
14 0.84
15 0.85
16 0.84
17 0.86
18 0.86
19 0.81
20 0.78
21 0.78
22 0.72
23 0.61
24 0.56
25 0.46
26 0.37
27 0.34
28 0.27
29 0.17
30 0.13
31 0.14
32 0.1
33 0.11
34 0.1
35 0.12
36 0.19
37 0.21
38 0.23
39 0.26
40 0.29
41 0.33
42 0.34
43 0.31
44 0.24
45 0.23
46 0.22
47 0.19
48 0.15
49 0.11
50 0.1
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.08
57 0.1
58 0.11
59 0.1
60 0.13
61 0.16
62 0.16
63 0.15
64 0.15
65 0.13
66 0.12
67 0.11
68 0.08
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.06
75 0.08
76 0.1
77 0.1
78 0.11
79 0.13
80 0.15
81 0.16
82 0.22
83 0.28
84 0.35
85 0.37
86 0.4
87 0.39
88 0.37
89 0.35
90 0.29
91 0.22
92 0.13
93 0.1
94 0.07
95 0.05
96 0.05
97 0.05
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.05
106 0.08
107 0.08
108 0.09
109 0.1
110 0.1
111 0.1
112 0.15
113 0.19
114 0.19
115 0.22
116 0.23
117 0.23
118 0.23
119 0.24
120 0.22
121 0.18
122 0.16
123 0.13
124 0.13
125 0.11
126 0.11
127 0.15
128 0.12
129 0.13
130 0.13
131 0.13
132 0.13
133 0.15
134 0.15
135 0.12
136 0.13
137 0.11
138 0.13
139 0.14
140 0.14
141 0.14
142 0.13
143 0.12
144 0.12
145 0.12
146 0.11
147 0.11
148 0.17
149 0.16
150 0.2
151 0.24
152 0.24
153 0.25
154 0.25
155 0.26
156 0.22
157 0.23
158 0.21
159 0.18
160 0.18
161 0.17
162 0.16
163 0.14
164 0.12
165 0.12
166 0.12
167 0.14
168 0.14
169 0.15
170 0.15
171 0.16
172 0.16
173 0.17
174 0.17
175 0.18
176 0.18
177 0.18
178 0.19
179 0.22
180 0.24
181 0.27
182 0.33
183 0.39
184 0.42
185 0.48
186 0.52
187 0.5
188 0.52
189 0.56
190 0.56
191 0.54
192 0.57
193 0.55
194 0.59
195 0.64
196 0.63
197 0.62