Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9M8F7

Protein Details
Accession M9M8F7    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
218-245FFATNAGKRARKKKKRKRGMSPVGPSLNHydrophilic
NLS Segment(s)
PositionSequence
224-236GKRARKKKKRKRG
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040052  RBM17  
Gene Ontology GO:0045292  P:mRNA cis splicing, via spliceosome  
Amino Acid Sequences MSAANQAFRGASLYAGIFDEAPSDAPQQDTASSKSGQEASATGDSAAGSSSKPSGNPGWSASLRFAPRRTGGAKPKSRPNAAFVASFAPVPPSDTPEQSSKAILVPPLPQHTSEAAETTSLPAAQLTKPSVSGVGKKDEQGKAGRLVETSDLKLTALALPQSADDGWLAAELDKYRVDSAPPYVLAPEEVERDKALARHPERGDEWDEAEADEDVNGFFATNAGKRARKKKKRKRGMSPVGPSLNGEYDPRVPNDYLAYKQVVYERRSAQLDQQKWQQEYDPQDWREYDDQQDQPHPEASRNHGPLTGEEAYQRRMAMSQPPAPGPPPRPPPSLQVADVDARQNAAAIAARLAALAPPPTDQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.09
5 0.09
6 0.1
7 0.09
8 0.1
9 0.11
10 0.13
11 0.13
12 0.14
13 0.15
14 0.15
15 0.18
16 0.19
17 0.2
18 0.22
19 0.22
20 0.22
21 0.24
22 0.25
23 0.22
24 0.2
25 0.18
26 0.2
27 0.21
28 0.2
29 0.16
30 0.15
31 0.14
32 0.13
33 0.13
34 0.08
35 0.06
36 0.07
37 0.1
38 0.11
39 0.11
40 0.15
41 0.19
42 0.22
43 0.24
44 0.25
45 0.29
46 0.29
47 0.31
48 0.29
49 0.31
50 0.33
51 0.35
52 0.35
53 0.33
54 0.34
55 0.38
56 0.39
57 0.42
58 0.47
59 0.53
60 0.6
61 0.61
62 0.69
63 0.71
64 0.74
65 0.67
66 0.62
67 0.58
68 0.51
69 0.46
70 0.37
71 0.32
72 0.26
73 0.24
74 0.19
75 0.14
76 0.11
77 0.14
78 0.13
79 0.16
80 0.17
81 0.19
82 0.22
83 0.24
84 0.27
85 0.25
86 0.25
87 0.2
88 0.2
89 0.2
90 0.18
91 0.16
92 0.16
93 0.19
94 0.23
95 0.23
96 0.22
97 0.23
98 0.23
99 0.24
100 0.2
101 0.18
102 0.14
103 0.13
104 0.13
105 0.12
106 0.11
107 0.08
108 0.07
109 0.07
110 0.08
111 0.08
112 0.11
113 0.12
114 0.12
115 0.12
116 0.12
117 0.15
118 0.15
119 0.19
120 0.19
121 0.23
122 0.24
123 0.26
124 0.32
125 0.3
126 0.32
127 0.3
128 0.29
129 0.29
130 0.3
131 0.28
132 0.22
133 0.21
134 0.21
135 0.2
136 0.18
137 0.14
138 0.12
139 0.11
140 0.11
141 0.1
142 0.08
143 0.07
144 0.07
145 0.06
146 0.06
147 0.06
148 0.07
149 0.06
150 0.06
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.05
158 0.05
159 0.06
160 0.06
161 0.07
162 0.08
163 0.08
164 0.08
165 0.08
166 0.1
167 0.1
168 0.1
169 0.1
170 0.09
171 0.09
172 0.09
173 0.09
174 0.08
175 0.09
176 0.09
177 0.09
178 0.09
179 0.1
180 0.1
181 0.11
182 0.13
183 0.2
184 0.21
185 0.29
186 0.29
187 0.32
188 0.32
189 0.34
190 0.34
191 0.26
192 0.25
193 0.18
194 0.17
195 0.14
196 0.14
197 0.1
198 0.07
199 0.06
200 0.05
201 0.04
202 0.04
203 0.04
204 0.03
205 0.03
206 0.04
207 0.05
208 0.06
209 0.1
210 0.13
211 0.19
212 0.25
213 0.36
214 0.47
215 0.57
216 0.68
217 0.76
218 0.83
219 0.9
220 0.94
221 0.94
222 0.94
223 0.94
224 0.93
225 0.88
226 0.84
227 0.75
228 0.64
229 0.53
230 0.43
231 0.33
232 0.24
233 0.19
234 0.13
235 0.16
236 0.18
237 0.19
238 0.2
239 0.19
240 0.19
241 0.22
242 0.23
243 0.2
244 0.21
245 0.21
246 0.18
247 0.19
248 0.24
249 0.27
250 0.27
251 0.31
252 0.31
253 0.34
254 0.37
255 0.36
256 0.39
257 0.42
258 0.43
259 0.42
260 0.47
261 0.49
262 0.47
263 0.47
264 0.42
265 0.39
266 0.42
267 0.44
268 0.45
269 0.39
270 0.41
271 0.41
272 0.43
273 0.4
274 0.36
275 0.34
276 0.34
277 0.35
278 0.36
279 0.41
280 0.38
281 0.37
282 0.39
283 0.35
284 0.32
285 0.33
286 0.37
287 0.42
288 0.42
289 0.4
290 0.38
291 0.38
292 0.34
293 0.37
294 0.32
295 0.23
296 0.24
297 0.25
298 0.25
299 0.26
300 0.25
301 0.18
302 0.17
303 0.19
304 0.23
305 0.28
306 0.32
307 0.34
308 0.36
309 0.37
310 0.39
311 0.44
312 0.4
313 0.42
314 0.46
315 0.48
316 0.51
317 0.52
318 0.55
319 0.57
320 0.57
321 0.49
322 0.42
323 0.4
324 0.38
325 0.38
326 0.34
327 0.26
328 0.22
329 0.2
330 0.17
331 0.13
332 0.12
333 0.12
334 0.1
335 0.1
336 0.1
337 0.1
338 0.09
339 0.1
340 0.09
341 0.09
342 0.11
343 0.11