Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9LS08

Protein Details
Accession M9LS08   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPSSKGKPTDPKKREEARKEBasic
113-149EDKPKEAAQPKKKTSKTQAKPPAKGTRTQPKRGAKKEBasic
NLS Segment(s)
PositionSequence
11-16PKKREE
65-149GAPKPKKEAVEKGERKDPSAPVGTPKTKKASNDNKDDSKTSGAKRKADEDKPKEAAQPKKKTSKTQAKPPAKGTRTQPKRGAKKE
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPSSKGKPTDPKKREEARKEVLNMEKGGGKGNWSAYKAAEMAKKYEAKGGGYEDTGDNANEAKTGAPKPKKEAVEKGERKDPSAPVGTPKTKKASNDNKDDSKTSGAKRKADEDKPKEAAQPKKKTSKTQAKPPAKGTRTQPKRGAKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.76
5 0.78
6 0.74
7 0.71
8 0.67
9 0.6
10 0.52
11 0.44
12 0.38
13 0.31
14 0.31
15 0.24
16 0.2
17 0.18
18 0.22
19 0.24
20 0.23
21 0.24
22 0.21
23 0.22
24 0.21
25 0.23
26 0.22
27 0.2
28 0.21
29 0.25
30 0.27
31 0.26
32 0.29
33 0.26
34 0.23
35 0.23
36 0.23
37 0.19
38 0.17
39 0.18
40 0.13
41 0.13
42 0.13
43 0.11
44 0.08
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.08
51 0.1
52 0.18
53 0.23
54 0.25
55 0.3
56 0.37
57 0.4
58 0.42
59 0.46
60 0.44
61 0.5
62 0.53
63 0.51
64 0.51
65 0.47
66 0.45
67 0.41
68 0.36
69 0.29
70 0.27
71 0.24
72 0.22
73 0.28
74 0.32
75 0.31
76 0.34
77 0.35
78 0.35
79 0.38
80 0.43
81 0.48
82 0.5
83 0.57
84 0.6
85 0.6
86 0.6
87 0.59
88 0.51
89 0.45
90 0.42
91 0.38
92 0.41
93 0.41
94 0.43
95 0.44
96 0.5
97 0.53
98 0.58
99 0.64
100 0.61
101 0.64
102 0.64
103 0.63
104 0.61
105 0.6
106 0.61
107 0.6
108 0.64
109 0.64
110 0.7
111 0.74
112 0.77
113 0.8
114 0.81
115 0.79
116 0.8
117 0.83
118 0.83
119 0.84
120 0.84
121 0.84
122 0.75
123 0.73
124 0.71
125 0.71
126 0.71
127 0.73
128 0.74
129 0.73