Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M9LR28

Protein Details
Accession M9LR28    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
25-62DAKIFKFCKSKCHKNFKLKRNPRKVRWTKAFRKANGKEHydrophilic
NLS Segment(s)
PositionSequence
40-58FKLKRNPRKVRWTKAFRKA
118-118K
Subcellular Location(s) mito 16, nucl 8, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR011017  TRASH_dom  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIEHCFFCSAPCYPGKGITFVRNDAKIFKFCKSKCHKNFKLKRNPRKVRWTKAFRKANGKEMTLDSTLEFEKKRNVPVRYDRQLVLTTLNAMKRIQEIKTRREIAFYKARMAKAGVKAKAKEADRLLVHRNAHLRASIEASKQSAAAAASSKIKVKATSAKPKSALVGAGNSAMSMRMDTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.32
3 0.31
4 0.33
5 0.34
6 0.38
7 0.39
8 0.4
9 0.44
10 0.4
11 0.4
12 0.4
13 0.4
14 0.39
15 0.38
16 0.39
17 0.43
18 0.41
19 0.51
20 0.55
21 0.62
22 0.66
23 0.75
24 0.79
25 0.8
26 0.9
27 0.9
28 0.92
29 0.91
30 0.92
31 0.92
32 0.93
33 0.91
34 0.92
35 0.91
36 0.9
37 0.9
38 0.89
39 0.88
40 0.88
41 0.88
42 0.81
43 0.82
44 0.75
45 0.74
46 0.68
47 0.59
48 0.51
49 0.44
50 0.42
51 0.32
52 0.29
53 0.19
54 0.16
55 0.15
56 0.15
57 0.14
58 0.11
59 0.17
60 0.18
61 0.26
62 0.31
63 0.33
64 0.38
65 0.47
66 0.55
67 0.54
68 0.55
69 0.48
70 0.43
71 0.42
72 0.35
73 0.27
74 0.17
75 0.14
76 0.14
77 0.14
78 0.12
79 0.11
80 0.11
81 0.13
82 0.15
83 0.15
84 0.21
85 0.25
86 0.29
87 0.37
88 0.41
89 0.38
90 0.4
91 0.4
92 0.38
93 0.42
94 0.38
95 0.36
96 0.36
97 0.36
98 0.33
99 0.34
100 0.33
101 0.33
102 0.39
103 0.37
104 0.38
105 0.39
106 0.42
107 0.46
108 0.41
109 0.39
110 0.33
111 0.34
112 0.31
113 0.34
114 0.35
115 0.34
116 0.33
117 0.31
118 0.33
119 0.29
120 0.29
121 0.27
122 0.24
123 0.2
124 0.24
125 0.24
126 0.21
127 0.22
128 0.22
129 0.21
130 0.19
131 0.18
132 0.14
133 0.11
134 0.1
135 0.1
136 0.11
137 0.14
138 0.16
139 0.19
140 0.2
141 0.21
142 0.21
143 0.24
144 0.32
145 0.38
146 0.48
147 0.51
148 0.55
149 0.56
150 0.56
151 0.54
152 0.46
153 0.4
154 0.31
155 0.29
156 0.23
157 0.22
158 0.2
159 0.17
160 0.15
161 0.13
162 0.11