Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9LZR4

Protein Details
Accession M9LZR4    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-105GRRTRRKSIGRTQRQKRGRYBasic
NLS Segment(s)
PositionSequence
86-103GRRTRRKSIGRTQRQKRG
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000630  Ribosomal_S8  
IPR035987  Ribosomal_S8_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00410  Ribosomal_S8  
PROSITE View protein in PROSITE  
PS00053  RIBOSOMAL_S8  
Amino Acid Sequences MVRISVLNDALNSIVNAERKGKRQVLVRPSSKVVIKFLSVMQKHGKFQPSPRTHSFPIPSPIALGQHLDISRVDIMQSWTAAPGIGRRTRRKSIGRTQRQKRGRYIGEFEEVDDHRSGKVVVQLNGRINKCGVISPRFNVQLGQIENWVQQLLPARSFGYVVLTTSAGIMDHEEARRKHVAGKILGYFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.22
5 0.26
6 0.31
7 0.39
8 0.42
9 0.44
10 0.49
11 0.56
12 0.59
13 0.64
14 0.64
15 0.61
16 0.59
17 0.59
18 0.55
19 0.48
20 0.41
21 0.33
22 0.29
23 0.26
24 0.27
25 0.31
26 0.28
27 0.3
28 0.35
29 0.36
30 0.38
31 0.42
32 0.44
33 0.38
34 0.45
35 0.52
36 0.5
37 0.54
38 0.57
39 0.58
40 0.55
41 0.59
42 0.54
43 0.48
44 0.46
45 0.41
46 0.35
47 0.29
48 0.27
49 0.22
50 0.2
51 0.15
52 0.11
53 0.12
54 0.12
55 0.12
56 0.11
57 0.11
58 0.11
59 0.1
60 0.1
61 0.08
62 0.09
63 0.09
64 0.09
65 0.08
66 0.08
67 0.08
68 0.08
69 0.06
70 0.07
71 0.12
72 0.16
73 0.22
74 0.29
75 0.35
76 0.4
77 0.47
78 0.51
79 0.55
80 0.6
81 0.65
82 0.7
83 0.74
84 0.77
85 0.79
86 0.8
87 0.77
88 0.73
89 0.7
90 0.64
91 0.58
92 0.54
93 0.47
94 0.43
95 0.39
96 0.33
97 0.29
98 0.24
99 0.22
100 0.18
101 0.16
102 0.12
103 0.12
104 0.12
105 0.09
106 0.15
107 0.17
108 0.19
109 0.22
110 0.26
111 0.31
112 0.37
113 0.37
114 0.31
115 0.28
116 0.26
117 0.23
118 0.23
119 0.22
120 0.21
121 0.24
122 0.25
123 0.3
124 0.3
125 0.3
126 0.27
127 0.24
128 0.26
129 0.25
130 0.24
131 0.2
132 0.19
133 0.19
134 0.2
135 0.18
136 0.1
137 0.1
138 0.17
139 0.18
140 0.18
141 0.18
142 0.18
143 0.19
144 0.19
145 0.18
146 0.14
147 0.13
148 0.12
149 0.13
150 0.12
151 0.12
152 0.12
153 0.12
154 0.07
155 0.07
156 0.08
157 0.09
158 0.12
159 0.15
160 0.22
161 0.23
162 0.28
163 0.32
164 0.31
165 0.35
166 0.36
167 0.41
168 0.39
169 0.45