Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9LX09

Protein Details
Accession M9LX09    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-35VVRQRASRPTQPEQPRRPRRRSRSQCKSIPSRTTHydrophilic
NLS Segment(s)
PositionSequence
16-23PRRPRRRS
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MVVRQRASRPTQPEQPRRPRRRSRSQCKSIPSRTTARQRQLRPDYSNPLHYPQALDLVFAGRASRPQHAAALLRCCTAALLPPALLRPRSASLILARSGSSLLGVDYRLVISPSSTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.85
4 0.87
5 0.91
6 0.92
7 0.91
8 0.92
9 0.92
10 0.93
11 0.92
12 0.92
13 0.89
14 0.86
15 0.86
16 0.83
17 0.77
18 0.71
19 0.66
20 0.65
21 0.68
22 0.68
23 0.67
24 0.67
25 0.65
26 0.71
27 0.73
28 0.71
29 0.67
30 0.64
31 0.63
32 0.57
33 0.59
34 0.5
35 0.45
36 0.39
37 0.33
38 0.29
39 0.2
40 0.22
41 0.16
42 0.14
43 0.11
44 0.11
45 0.1
46 0.09
47 0.09
48 0.04
49 0.08
50 0.09
51 0.11
52 0.12
53 0.13
54 0.14
55 0.15
56 0.19
57 0.19
58 0.22
59 0.21
60 0.2
61 0.19
62 0.18
63 0.16
64 0.13
65 0.13
66 0.1
67 0.1
68 0.1
69 0.11
70 0.14
71 0.16
72 0.16
73 0.14
74 0.16
75 0.17
76 0.2
77 0.2
78 0.19
79 0.21
80 0.24
81 0.24
82 0.21
83 0.19
84 0.17
85 0.16
86 0.14
87 0.11
88 0.07
89 0.07
90 0.07
91 0.08
92 0.07
93 0.08
94 0.09
95 0.09
96 0.09
97 0.09
98 0.09