Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9M7U6

Protein Details
Accession M9M7U6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-48QGDYKEKPKLHQPRWRRACPPRRGAEFRRCSTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, mito 5, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRAVAIVGWSRIERRAQGDYKEKPKLHQPRWRRACPPRRGAEFRRCSTSTHHPQLNPEFCPLNITIAITITITITITITITITITITITITITITITITITIAIAIHTLHKRDTPLNHPFGSATARPSGSSSAAPTGSASMSGNMTASSNSTSNMTSTSTTPTTFPIATVPTTGYLAGTAAAPAPGGGSGASGSSALGPNDSHIVSAAQVLRSSAAAISASMLALGVGVWVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.35
3 0.38
4 0.44
5 0.52
6 0.57
7 0.63
8 0.69
9 0.65
10 0.6
11 0.65
12 0.69
13 0.69
14 0.7
15 0.71
16 0.73
17 0.82
18 0.86
19 0.85
20 0.85
21 0.86
22 0.86
23 0.86
24 0.84
25 0.83
26 0.83
27 0.82
28 0.82
29 0.81
30 0.74
31 0.72
32 0.64
33 0.57
34 0.55
35 0.57
36 0.56
37 0.55
38 0.57
39 0.51
40 0.56
41 0.64
42 0.61
43 0.52
44 0.45
45 0.38
46 0.32
47 0.34
48 0.28
49 0.21
50 0.16
51 0.15
52 0.12
53 0.11
54 0.12
55 0.08
56 0.08
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.07
94 0.08
95 0.08
96 0.09
97 0.1
98 0.12
99 0.15
100 0.18
101 0.22
102 0.28
103 0.31
104 0.31
105 0.3
106 0.28
107 0.26
108 0.26
109 0.2
110 0.15
111 0.13
112 0.13
113 0.13
114 0.14
115 0.14
116 0.12
117 0.12
118 0.11
119 0.11
120 0.11
121 0.11
122 0.1
123 0.09
124 0.08
125 0.08
126 0.07
127 0.06
128 0.06
129 0.06
130 0.06
131 0.06
132 0.06
133 0.05
134 0.06
135 0.07
136 0.07
137 0.08
138 0.09
139 0.09
140 0.09
141 0.1
142 0.11
143 0.1
144 0.11
145 0.14
146 0.15
147 0.15
148 0.15
149 0.16
150 0.18
151 0.16
152 0.16
153 0.13
154 0.14
155 0.14
156 0.14
157 0.13
158 0.11
159 0.12
160 0.11
161 0.09
162 0.07
163 0.07
164 0.07
165 0.06
166 0.05
167 0.05
168 0.05
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.04
178 0.05
179 0.05
180 0.05
181 0.06
182 0.08
183 0.08
184 0.09
185 0.09
186 0.1
187 0.12
188 0.12
189 0.11
190 0.1
191 0.1
192 0.1
193 0.14
194 0.15
195 0.14
196 0.14
197 0.14
198 0.14
199 0.14
200 0.14
201 0.1
202 0.09
203 0.08
204 0.08
205 0.09
206 0.08
207 0.08
208 0.07
209 0.07
210 0.05
211 0.05
212 0.05
213 0.03