Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9M2K2

Protein Details
Accession M9M2K2   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-39LMLYKASKKHQQPHHLAPAPAHydrophilic
379-406EKISSWNRSAKRRREKKAQAKAHKEAAFHydrophilic
NLS Segment(s)
PositionSequence
386-402RSAKRRREKKAQAKAHK
Subcellular Location(s) extr 22, pero 2, nucl 1, mito 1, cyto 1, cyto_nucl 1, cyto_mito 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR019303  vWA_TerF_C  
IPR002035  VWF_A  
IPR036465  vWFA_dom_sf  
Pfam View protein in Pfam  
PF10138  vWA-TerF-like  
PROSITE View protein in PROSITE  
PS50234  VWFA  
Amino Acid Sequences MGFNKKLIVAGLAVGITALMLYKASKKHQQPHHLAPAPAQHSAMSSSNHSHAASLGGAALGGAAVAAAGAAYAHHNAAAAPPPSANNPNVTWDSLRDWRHIANLLATCVMDQYLYPFYTFADVSRIAHHLASSGALAQCADSWQLPPYLAQDLVKLALFDVMFLLDDSASMRSEGTRRRDALAGILKRAADAAARFDPDGMEVAWMNAPVHQRIHNVQEADQLTSRCAYDGRSTPMGSSLESKILEPLVLQPAQQGRLAKPALVLVITDGRPTGSGEANQKIVRVLQHAKRTLAATRYGEDAISFQIAAVGNDREAQEWLDSIDNDPDVGDLVDVCSDIQVESRQVKASTGVELTQELYCLKLLLGPIDTSYDASDENEKISSWNRSAKRRREKKAQAKAHKEAAFRAQMDAFRRDRDAALQGATPVPSAGGALPPQVVDDGLSGYSHQPGYPQQPQQGAYPPAAAGYPQQPGGYPQQGGGYPQPQQAGGYPQPGGGYAQPQQSGYPQPGSAYPQPGSGYPQAGGGYPQPGGGGYAAPGYQPYGSGPSSAPPPYPDAYGSRDIPAAGNSSYAPAPGSGGFVPGAGGFAMPNPHVGGAPPSDSHQHQQQPFGFPQPKPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.06
4 0.05
5 0.04
6 0.03
7 0.04
8 0.05
9 0.11
10 0.17
11 0.23
12 0.33
13 0.42
14 0.51
15 0.61
16 0.7
17 0.74
18 0.79
19 0.84
20 0.81
21 0.73
22 0.67
23 0.66
24 0.59
25 0.51
26 0.41
27 0.3
28 0.25
29 0.28
30 0.28
31 0.21
32 0.21
33 0.24
34 0.26
35 0.28
36 0.27
37 0.23
38 0.2
39 0.2
40 0.17
41 0.13
42 0.11
43 0.08
44 0.07
45 0.07
46 0.06
47 0.04
48 0.03
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.01
55 0.02
56 0.02
57 0.02
58 0.04
59 0.05
60 0.06
61 0.06
62 0.06
63 0.07
64 0.09
65 0.15
66 0.14
67 0.14
68 0.15
69 0.17
70 0.21
71 0.25
72 0.24
73 0.23
74 0.23
75 0.28
76 0.29
77 0.3
78 0.27
79 0.25
80 0.29
81 0.33
82 0.34
83 0.31
84 0.32
85 0.31
86 0.33
87 0.34
88 0.29
89 0.28
90 0.27
91 0.26
92 0.24
93 0.22
94 0.18
95 0.15
96 0.14
97 0.08
98 0.06
99 0.08
100 0.11
101 0.12
102 0.12
103 0.12
104 0.12
105 0.14
106 0.15
107 0.12
108 0.13
109 0.14
110 0.14
111 0.17
112 0.18
113 0.17
114 0.17
115 0.16
116 0.12
117 0.12
118 0.11
119 0.09
120 0.1
121 0.09
122 0.09
123 0.09
124 0.08
125 0.08
126 0.08
127 0.09
128 0.07
129 0.08
130 0.09
131 0.1
132 0.11
133 0.11
134 0.13
135 0.14
136 0.14
137 0.14
138 0.13
139 0.13
140 0.14
141 0.13
142 0.11
143 0.09
144 0.1
145 0.1
146 0.09
147 0.08
148 0.07
149 0.07
150 0.07
151 0.07
152 0.04
153 0.04
154 0.05
155 0.06
156 0.06
157 0.06
158 0.07
159 0.08
160 0.13
161 0.2
162 0.26
163 0.31
164 0.33
165 0.35
166 0.36
167 0.35
168 0.38
169 0.4
170 0.35
171 0.3
172 0.3
173 0.27
174 0.26
175 0.25
176 0.18
177 0.11
178 0.1
179 0.13
180 0.13
181 0.15
182 0.15
183 0.14
184 0.14
185 0.13
186 0.13
187 0.08
188 0.07
189 0.06
190 0.07
191 0.07
192 0.08
193 0.07
194 0.09
195 0.11
196 0.11
197 0.13
198 0.15
199 0.17
200 0.19
201 0.24
202 0.24
203 0.24
204 0.23
205 0.28
206 0.27
207 0.26
208 0.26
209 0.22
210 0.19
211 0.18
212 0.18
213 0.12
214 0.11
215 0.11
216 0.13
217 0.17
218 0.21
219 0.23
220 0.23
221 0.23
222 0.26
223 0.24
224 0.2
225 0.19
226 0.15
227 0.16
228 0.16
229 0.16
230 0.13
231 0.13
232 0.12
233 0.09
234 0.1
235 0.11
236 0.11
237 0.11
238 0.13
239 0.15
240 0.16
241 0.18
242 0.17
243 0.14
244 0.2
245 0.2
246 0.18
247 0.16
248 0.15
249 0.14
250 0.12
251 0.11
252 0.06
253 0.09
254 0.09
255 0.09
256 0.08
257 0.08
258 0.08
259 0.09
260 0.1
261 0.07
262 0.1
263 0.14
264 0.15
265 0.18
266 0.18
267 0.18
268 0.16
269 0.16
270 0.14
271 0.15
272 0.2
273 0.23
274 0.3
275 0.32
276 0.32
277 0.32
278 0.33
279 0.31
280 0.27
281 0.25
282 0.19
283 0.18
284 0.19
285 0.18
286 0.17
287 0.14
288 0.12
289 0.09
290 0.07
291 0.06
292 0.04
293 0.06
294 0.07
295 0.06
296 0.07
297 0.07
298 0.07
299 0.09
300 0.09
301 0.08
302 0.08
303 0.08
304 0.07
305 0.07
306 0.08
307 0.07
308 0.07
309 0.07
310 0.07
311 0.07
312 0.07
313 0.06
314 0.05
315 0.05
316 0.05
317 0.04
318 0.03
319 0.03
320 0.03
321 0.03
322 0.03
323 0.03
324 0.03
325 0.03
326 0.04
327 0.05
328 0.07
329 0.09
330 0.1
331 0.11
332 0.12
333 0.12
334 0.13
335 0.13
336 0.12
337 0.12
338 0.11
339 0.1
340 0.1
341 0.12
342 0.09
343 0.09
344 0.07
345 0.07
346 0.07
347 0.06
348 0.06
349 0.06
350 0.06
351 0.07
352 0.08
353 0.07
354 0.07
355 0.09
356 0.09
357 0.08
358 0.08
359 0.07
360 0.07
361 0.08
362 0.1
363 0.09
364 0.1
365 0.1
366 0.09
367 0.1
368 0.13
369 0.15
370 0.16
371 0.24
372 0.28
373 0.38
374 0.48
375 0.57
376 0.66
377 0.72
378 0.78
379 0.81
380 0.87
381 0.88
382 0.89
383 0.89
384 0.88
385 0.87
386 0.84
387 0.81
388 0.75
389 0.65
390 0.56
391 0.51
392 0.46
393 0.37
394 0.34
395 0.27
396 0.25
397 0.28
398 0.32
399 0.28
400 0.25
401 0.26
402 0.26
403 0.24
404 0.24
405 0.23
406 0.18
407 0.18
408 0.16
409 0.15
410 0.15
411 0.15
412 0.12
413 0.09
414 0.07
415 0.06
416 0.06
417 0.05
418 0.06
419 0.06
420 0.07
421 0.07
422 0.07
423 0.07
424 0.07
425 0.07
426 0.06
427 0.06
428 0.06
429 0.06
430 0.06
431 0.07
432 0.07
433 0.1
434 0.09
435 0.09
436 0.1
437 0.14
438 0.21
439 0.28
440 0.31
441 0.33
442 0.37
443 0.38
444 0.39
445 0.43
446 0.37
447 0.31
448 0.28
449 0.23
450 0.2
451 0.18
452 0.16
453 0.11
454 0.12
455 0.13
456 0.13
457 0.13
458 0.13
459 0.16
460 0.22
461 0.23
462 0.2
463 0.19
464 0.21
465 0.21
466 0.24
467 0.24
468 0.21
469 0.21
470 0.23
471 0.23
472 0.21
473 0.21
474 0.2
475 0.24
476 0.23
477 0.23
478 0.21
479 0.2
480 0.2
481 0.2
482 0.2
483 0.14
484 0.15
485 0.17
486 0.2
487 0.2
488 0.21
489 0.21
490 0.23
491 0.25
492 0.25
493 0.23
494 0.2
495 0.2
496 0.22
497 0.27
498 0.28
499 0.3
500 0.27
501 0.27
502 0.28
503 0.28
504 0.31
505 0.28
506 0.25
507 0.2
508 0.22
509 0.19
510 0.18
511 0.19
512 0.16
513 0.15
514 0.13
515 0.13
516 0.11
517 0.1
518 0.11
519 0.1
520 0.08
521 0.07
522 0.08
523 0.08
524 0.08
525 0.08
526 0.09
527 0.08
528 0.08
529 0.09
530 0.12
531 0.13
532 0.14
533 0.15
534 0.16
535 0.2
536 0.22
537 0.22
538 0.19
539 0.24
540 0.24
541 0.25
542 0.25
543 0.24
544 0.28
545 0.32
546 0.31
547 0.28
548 0.28
549 0.26
550 0.25
551 0.23
552 0.2
553 0.15
554 0.15
555 0.13
556 0.15
557 0.15
558 0.14
559 0.13
560 0.1
561 0.11
562 0.11
563 0.14
564 0.11
565 0.12
566 0.12
567 0.11
568 0.12
569 0.1
570 0.1
571 0.07
572 0.07
573 0.05
574 0.07
575 0.1
576 0.1
577 0.11
578 0.11
579 0.12
580 0.12
581 0.13
582 0.15
583 0.15
584 0.18
585 0.17
586 0.19
587 0.24
588 0.27
589 0.31
590 0.36
591 0.42
592 0.43
593 0.5
594 0.53
595 0.55
596 0.54
597 0.59
598 0.58