Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R4S6

Protein Details
Accession F4R4S6   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-22YGFPVKCGRFVKKRKRVAVVIHydrophilic
30-60EEETAARKTRKKSKKSNTKPNRKPTNQSKGSHydrophilic
NLS Segment(s)
PositionSequence
36-59RKTRKKSKKSNTKPNRKPTNQSKG
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_101452  -  
Amino Acid Sequences MYGFPVKCGRFVKKRKRVAVVIGDTSEEEEEETAARKTRKKSKKSNTKPNRKPTNQSKGSSKDKHLSKNVTTAILRADSGEEDEVIAIKSQKLQDSRSELDKLRAYFDAPIYELKDVSGSFYVLTSLLSVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.83
4 0.79
5 0.77
6 0.76
7 0.71
8 0.64
9 0.54
10 0.46
11 0.38
12 0.35
13 0.26
14 0.16
15 0.1
16 0.07
17 0.07
18 0.06
19 0.08
20 0.08
21 0.12
22 0.16
23 0.21
24 0.28
25 0.39
26 0.48
27 0.57
28 0.67
29 0.73
30 0.82
31 0.87
32 0.91
33 0.92
34 0.93
35 0.93
36 0.93
37 0.93
38 0.86
39 0.85
40 0.84
41 0.84
42 0.79
43 0.73
44 0.69
45 0.65
46 0.69
47 0.64
48 0.57
49 0.53
50 0.51
51 0.54
52 0.52
53 0.5
54 0.42
55 0.44
56 0.41
57 0.36
58 0.31
59 0.25
60 0.21
61 0.17
62 0.16
63 0.1
64 0.1
65 0.07
66 0.08
67 0.08
68 0.06
69 0.06
70 0.06
71 0.06
72 0.05
73 0.06
74 0.05
75 0.05
76 0.09
77 0.11
78 0.15
79 0.18
80 0.2
81 0.25
82 0.31
83 0.34
84 0.35
85 0.38
86 0.35
87 0.38
88 0.41
89 0.35
90 0.32
91 0.29
92 0.26
93 0.25
94 0.25
95 0.22
96 0.18
97 0.2
98 0.19
99 0.2
100 0.18
101 0.16
102 0.16
103 0.13
104 0.15
105 0.14
106 0.12
107 0.11
108 0.11
109 0.12
110 0.1
111 0.1