Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RYK7

Protein Details
Accession F4RYK7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
132-159LERKAQVQNKKAIKKKKKDEEESDEEKYBasic
NLS Segment(s)
PositionSequence
141-149KKAIKKKKK
Subcellular Location(s) nucl 15.5, mito_nucl 10, cyto 6, mito 3.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_110076  -  
Amino Acid Sequences MWYKPKCLKALAKETEQLPTCNRGNMGSSETVKLCTTREPSPAVPSDQGPNHPAPIGTPAQQEVPRGRPMDEDSDEQEEVVRKRGVVVENGIKYATGEVSIHHLPKLTTFWDNQIREIKGYVPILMFNHSWLERKAQVQNKKAIKKKKKDEEESDEEKYEGLNYPAEQRLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.58
3 0.51
4 0.44
5 0.36
6 0.37
7 0.34
8 0.32
9 0.31
10 0.25
11 0.26
12 0.26
13 0.27
14 0.25
15 0.25
16 0.25
17 0.25
18 0.26
19 0.23
20 0.22
21 0.19
22 0.2
23 0.22
24 0.23
25 0.26
26 0.28
27 0.29
28 0.34
29 0.35
30 0.33
31 0.3
32 0.28
33 0.3
34 0.27
35 0.28
36 0.26
37 0.24
38 0.22
39 0.21
40 0.19
41 0.14
42 0.17
43 0.17
44 0.15
45 0.15
46 0.15
47 0.18
48 0.19
49 0.21
50 0.2
51 0.22
52 0.24
53 0.24
54 0.24
55 0.22
56 0.24
57 0.27
58 0.26
59 0.24
60 0.22
61 0.24
62 0.24
63 0.21
64 0.2
65 0.17
66 0.15
67 0.17
68 0.15
69 0.11
70 0.12
71 0.16
72 0.16
73 0.14
74 0.16
75 0.18
76 0.18
77 0.19
78 0.18
79 0.15
80 0.13
81 0.13
82 0.1
83 0.05
84 0.05
85 0.05
86 0.1
87 0.11
88 0.12
89 0.11
90 0.12
91 0.11
92 0.13
93 0.14
94 0.12
95 0.13
96 0.13
97 0.19
98 0.27
99 0.28
100 0.3
101 0.35
102 0.33
103 0.32
104 0.32
105 0.27
106 0.22
107 0.22
108 0.19
109 0.14
110 0.14
111 0.15
112 0.17
113 0.16
114 0.12
115 0.15
116 0.15
117 0.17
118 0.17
119 0.21
120 0.21
121 0.26
122 0.33
123 0.38
124 0.46
125 0.51
126 0.59
127 0.63
128 0.7
129 0.74
130 0.77
131 0.79
132 0.8
133 0.85
134 0.87
135 0.88
136 0.89
137 0.9
138 0.88
139 0.86
140 0.82
141 0.76
142 0.66
143 0.55
144 0.46
145 0.36
146 0.28
147 0.22
148 0.17
149 0.15
150 0.14
151 0.2