Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M9MH76

Protein Details
Accession M9MH76   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MTRTRHGKKTHHARRDVKRGMRTRARKLDPBasic
NLS Segment(s)
PositionSequence
5-27RHGKKTHHARRDVKRGMRTRARK
88-89RR
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MTRTRHGKKTHHARRDVKRGMRTRARKLDPDQIQANLNNPQRLDELQNPKELDVDKAGLGLFYCVECDRNFPSQKDQLTHIASKLHKRRAKKITEEPAYTIEESLRAVGMGIDNKQRTKPEAAKEAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.88
4 0.85
5 0.84
6 0.82
7 0.82
8 0.83
9 0.81
10 0.8
11 0.81
12 0.78
13 0.76
14 0.73
15 0.73
16 0.68
17 0.65
18 0.58
19 0.49
20 0.46
21 0.4
22 0.37
23 0.35
24 0.33
25 0.29
26 0.26
27 0.26
28 0.24
29 0.25
30 0.27
31 0.28
32 0.34
33 0.33
34 0.38
35 0.36
36 0.35
37 0.35
38 0.31
39 0.24
40 0.16
41 0.15
42 0.11
43 0.11
44 0.11
45 0.08
46 0.08
47 0.06
48 0.05
49 0.04
50 0.04
51 0.04
52 0.06
53 0.06
54 0.08
55 0.11
56 0.18
57 0.21
58 0.22
59 0.27
60 0.31
61 0.34
62 0.33
63 0.33
64 0.32
65 0.33
66 0.33
67 0.28
68 0.28
69 0.28
70 0.36
71 0.41
72 0.45
73 0.45
74 0.5
75 0.59
76 0.63
77 0.69
78 0.69
79 0.71
80 0.72
81 0.75
82 0.72
83 0.64
84 0.58
85 0.52
86 0.44
87 0.34
88 0.23
89 0.17
90 0.15
91 0.13
92 0.1
93 0.07
94 0.06
95 0.06
96 0.09
97 0.11
98 0.13
99 0.2
100 0.24
101 0.26
102 0.3
103 0.32
104 0.34
105 0.41
106 0.45
107 0.47