Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NS67

Protein Details
Accession M7NS67   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-28GLTKLTKKSAKTRHKPVQLKRGARIHydrophilic
63-87GFSKNFSLIKKQKKNNLLFRTKHKTHydrophilic
NLS Segment(s)
PositionSequence
10-38KKSAKTRHKPVQLKRGARIISAKKASIRK
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MTQGLTKLTKKSAKTRHKPVQLKRGARIISAKKASIRKAQNLQRMLTKSINEKNEAILAQRAGFSKNFSLIKKQKKNNLLFRTKHKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.8
4 0.84
5 0.88
6 0.88
7 0.88
8 0.86
9 0.82
10 0.75
11 0.72
12 0.62
13 0.55
14 0.54
15 0.48
16 0.46
17 0.43
18 0.4
19 0.38
20 0.42
21 0.44
22 0.44
23 0.44
24 0.42
25 0.48
26 0.54
27 0.56
28 0.54
29 0.51
30 0.48
31 0.45
32 0.42
33 0.36
34 0.3
35 0.29
36 0.32
37 0.33
38 0.3
39 0.28
40 0.26
41 0.25
42 0.24
43 0.19
44 0.15
45 0.14
46 0.12
47 0.13
48 0.13
49 0.13
50 0.13
51 0.15
52 0.14
53 0.2
54 0.23
55 0.23
56 0.33
57 0.4
58 0.5
59 0.58
60 0.64
61 0.68
62 0.74
63 0.82
64 0.83
65 0.84
66 0.83
67 0.8