Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7NPW8

Protein Details
Accession M7NPW8   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-116LIDDAPKPKQKKKEASRSRGRDRGRGRARRGRSARGFBasic
NLS Segment(s)
PositionSequence
85-116PKPKQKKKEASRSRGRDRGRGRARRGRSARGF
Subcellular Location(s) cyto_nucl 11, nucl 9.5, cyto 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR034102  Sm_D1  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0120114  C:Sm-like protein family complex  
GO:0000387  P:spliceosomal snRNP assembly  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01724  Sm_D1  
Amino Acid Sequences MKLVRFLMKLINETVSIELKNGTIVNGTIVAVDMQMNTHLKTVKMSVFHKDPVCLDTLSIRGNNIRYFILPDSLPLDTLLIDDAPKPKQKKKEASRSRGRDRGRGRARRGRSARGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.17
4 0.15
5 0.14
6 0.12
7 0.13
8 0.12
9 0.1
10 0.08
11 0.08
12 0.08
13 0.08
14 0.08
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.05
21 0.04
22 0.07
23 0.08
24 0.08
25 0.1
26 0.11
27 0.11
28 0.12
29 0.14
30 0.14
31 0.18
32 0.19
33 0.22
34 0.24
35 0.28
36 0.27
37 0.26
38 0.24
39 0.21
40 0.21
41 0.16
42 0.13
43 0.1
44 0.11
45 0.11
46 0.11
47 0.1
48 0.1
49 0.12
50 0.12
51 0.13
52 0.12
53 0.11
54 0.13
55 0.13
56 0.14
57 0.12
58 0.12
59 0.13
60 0.12
61 0.12
62 0.1
63 0.09
64 0.07
65 0.07
66 0.07
67 0.05
68 0.05
69 0.07
70 0.1
71 0.13
72 0.2
73 0.25
74 0.32
75 0.42
76 0.51
77 0.61
78 0.68
79 0.76
80 0.8
81 0.86
82 0.9
83 0.9
84 0.9
85 0.88
86 0.82
87 0.8
88 0.76
89 0.77
90 0.77
91 0.77
92 0.77
93 0.78
94 0.8
95 0.82
96 0.82