Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7PID7

Protein Details
Accession M7PID7   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-88IFEGIKHKVKNKKQYQQYLDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, mito 7, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003204  Cyt_c_oxidase_su5A/6  
IPR036545  Cyt_c_oxidase_su5A/6_sf  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
GO:0046872  F:metal ion binding  
GO:0006123  P:mitochondrial electron transport, cytochrome c to oxygen  
Pfam View protein in Pfam  
PF02284  COX5A  
CDD cd00923  Cyt_c_Oxidase_Va  
Amino Acid Sequences MSHSQDRNNFESFNEKYEKFFKNVEDLFELQRGLNNAFAYDFVPMPSVIEEALRAARRVNDFPTAVRIFEGIKHKVKNKKQYQQYLDELKSLREELGISLKEELM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.32
4 0.38
5 0.4
6 0.35
7 0.36
8 0.33
9 0.36
10 0.36
11 0.36
12 0.32
13 0.31
14 0.3
15 0.28
16 0.26
17 0.18
18 0.18
19 0.17
20 0.14
21 0.14
22 0.12
23 0.11
24 0.11
25 0.11
26 0.1
27 0.09
28 0.09
29 0.06
30 0.07
31 0.07
32 0.07
33 0.07
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.08
40 0.08
41 0.08
42 0.08
43 0.11
44 0.14
45 0.15
46 0.17
47 0.18
48 0.18
49 0.18
50 0.25
51 0.22
52 0.2
53 0.18
54 0.17
55 0.13
56 0.18
57 0.23
58 0.22
59 0.27
60 0.31
61 0.38
62 0.47
63 0.56
64 0.62
65 0.66
66 0.71
67 0.76
68 0.82
69 0.81
70 0.78
71 0.77
72 0.75
73 0.66
74 0.61
75 0.51
76 0.42
77 0.38
78 0.32
79 0.24
80 0.17
81 0.16
82 0.14
83 0.21
84 0.2
85 0.19