Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M7P7F4

Protein Details
Accession M7P7F4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-64KTLVDRPFKKRLRPGMKKEDIPIBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 5, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005301  MOB_kinase_act_fam  
IPR036703  MOB_kinase_act_sf  
Pfam View protein in Pfam  
PF03637  Mob1_phocein  
Amino Acid Sequences MSSFAHSKGSVKPLSEDLTCVNTIPLLNEPIKSSVDESLDIKTLVDRPFKKRLRPGMKKEDIPIVPLIELNFEGPFSLEEYLDGLLSNETSHPMSVKRTKEIAEPPKGVDPWIWVYELIRRFIVDLNLLVVGMLEDSCSPEKCPEMRANEWQYLCACHNPPQECVAIDYILHTLDNTSTLLCSDKYFPSKISIPLSSTRHFSSIMRRLYRIFNHAWYKHYEIFWKVENEISLYRRFMAVSEYYHFKYEHSDMVNEAYSKEIEDGYHQDQEKVDNYNPQTLNDHNYKTLNNSYEYDKENRGNKNMLAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.32
4 0.27
5 0.27
6 0.26
7 0.23
8 0.19
9 0.16
10 0.16
11 0.16
12 0.16
13 0.17
14 0.18
15 0.19
16 0.21
17 0.22
18 0.23
19 0.22
20 0.21
21 0.2
22 0.21
23 0.21
24 0.2
25 0.2
26 0.2
27 0.19
28 0.17
29 0.16
30 0.19
31 0.22
32 0.3
33 0.33
34 0.38
35 0.48
36 0.54
37 0.61
38 0.65
39 0.71
40 0.74
41 0.79
42 0.83
43 0.83
44 0.85
45 0.8
46 0.74
47 0.72
48 0.6
49 0.52
50 0.44
51 0.34
52 0.26
53 0.23
54 0.2
55 0.13
56 0.12
57 0.11
58 0.09
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.07
66 0.07
67 0.08
68 0.08
69 0.08
70 0.07
71 0.06
72 0.05
73 0.06
74 0.06
75 0.05
76 0.07
77 0.07
78 0.07
79 0.08
80 0.1
81 0.16
82 0.23
83 0.26
84 0.28
85 0.3
86 0.31
87 0.36
88 0.44
89 0.46
90 0.46
91 0.45
92 0.43
93 0.45
94 0.44
95 0.38
96 0.29
97 0.23
98 0.2
99 0.19
100 0.18
101 0.13
102 0.14
103 0.19
104 0.21
105 0.19
106 0.16
107 0.15
108 0.15
109 0.17
110 0.17
111 0.12
112 0.09
113 0.09
114 0.09
115 0.08
116 0.07
117 0.05
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.05
124 0.06
125 0.06
126 0.07
127 0.08
128 0.11
129 0.11
130 0.15
131 0.18
132 0.23
133 0.26
134 0.33
135 0.36
136 0.38
137 0.37
138 0.34
139 0.29
140 0.26
141 0.24
142 0.19
143 0.17
144 0.19
145 0.24
146 0.25
147 0.25
148 0.26
149 0.26
150 0.23
151 0.23
152 0.17
153 0.12
154 0.1
155 0.1
156 0.08
157 0.07
158 0.07
159 0.05
160 0.05
161 0.05
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.06
168 0.07
169 0.08
170 0.1
171 0.13
172 0.16
173 0.17
174 0.18
175 0.21
176 0.23
177 0.26
178 0.27
179 0.25
180 0.24
181 0.3
182 0.33
183 0.3
184 0.3
185 0.28
186 0.25
187 0.25
188 0.24
189 0.27
190 0.31
191 0.37
192 0.37
193 0.37
194 0.38
195 0.43
196 0.44
197 0.4
198 0.34
199 0.34
200 0.4
201 0.41
202 0.41
203 0.4
204 0.42
205 0.41
206 0.39
207 0.36
208 0.3
209 0.31
210 0.33
211 0.3
212 0.25
213 0.24
214 0.23
215 0.22
216 0.23
217 0.22
218 0.21
219 0.2
220 0.19
221 0.18
222 0.18
223 0.15
224 0.16
225 0.16
226 0.16
227 0.19
228 0.23
229 0.24
230 0.26
231 0.26
232 0.22
233 0.25
234 0.24
235 0.26
236 0.24
237 0.24
238 0.22
239 0.25
240 0.27
241 0.22
242 0.2
243 0.16
244 0.14
245 0.14
246 0.14
247 0.11
248 0.09
249 0.12
250 0.18
251 0.2
252 0.26
253 0.26
254 0.27
255 0.27
256 0.3
257 0.3
258 0.3
259 0.28
260 0.29
261 0.32
262 0.39
263 0.39
264 0.38
265 0.38
266 0.36
267 0.4
268 0.39
269 0.39
270 0.34
271 0.36
272 0.35
273 0.37
274 0.42
275 0.38
276 0.35
277 0.35
278 0.36
279 0.39
280 0.42
281 0.42
282 0.41
283 0.45
284 0.48
285 0.53
286 0.53
287 0.53